close

SimulationCraft 725-01

for World of Warcraft 7.2.5 Live (wow build level 24287, git build 3c335a3)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Portal to the Underworld damage increased by 33%.
Dragged to Helheim (effect#1) ap_coefficient 1.60 1.20

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-1-8 Spelldata claims that Marking Target's rppm was buffed from 5 to 6.5, but testing shows higher.
Hunter's Mark rppm 7.20 6.50

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 38.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00
2017-01-11 Incorrect spell level for Frozen Orb Bolt.
Frozen Orb spell_level 57.00 81.00

Mark of the Distant Army

Tag Spell / Effect Field Hotfixed Value DBC Value
2017-01-10 Set Velocity to a reasonable value.
Mark of the Distant Army prj_speed 40.00 1.00

Table of Contents

Raid Summary

 

Actions per Minute / DPS Variance Summary

Charm + Sentinel : 1281183 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1281183.2 1281183.2 855.3 / 0.067% 269601.3 / 21.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Sentinel 1281183
Earth Shock 283892 22.2% 51.6 5.64sec 1649685 1580703 Direct 51.6 1199388 3444266 1649680 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.63 51.63 0.00 0.00 1.0437 0.0000 85166676.02 85166676.02 0.00 1580702.61 1580702.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.27 79.94% 1199387.66 741258 1619485 1199015.76 1007786 1384076 49497930 49497930 0.00
crit 10.36 20.06% 3444265.91 2128892 4651160 3442252.03 2370742 4470619 35668746 35668746 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 125110 9.8% 11.3 27.13sec 3312218 3220982 Direct 11.3 90004 262791 216564 73.2%  
Periodic 217.4 49614 198865 161366 74.9% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 217.40 217.40 1.0284 1.3718 37534101.91 37534101.91 0.00 121128.54 3220981.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.03 26.76% 90004.44 80604 98617 89629.30 0 98617 272901 272901 0.00
crit 8.30 73.24% 262791.13 231494 283227 262850.64 249964 275261 2181143 2181143 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.6 25.13% 49614.40 141 54240 49623.71 46598 51536 2710112 2710112 0.00
crit 162.8 74.87% 198864.74 284 218089 198881.98 190647 206347 32369947 32369947 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 310112 (471729) 24.2% (36.8%) 98.6 3.02sec 1435370 1126204 Direct 98.4 0 945708 945708 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.59 98.37 0.00 0.00 1.2745 0.0000 93033695.42 93033695.42 0.00 1126203.56 1126203.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.37 100.00% 945707.71 763198 1137267 944339.31 882831 1015652 93033695 93033695 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 147940 11.5% 59.0 5.03sec 751649 0 Direct 58.9 0 753734 753734 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.05 58.88 0.00 0.00 0.0000 0.0000 44381857.27 44381857.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 58.88 100.00% 753733.59 608227 906338 752641.77 690088 808098 44381857 44381857 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13677 1.1% 73.3 3.84sec 55974 0 Direct 73.3 46305 94458 55972 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.31 73.31 0.00 0.00 0.0000 0.0000 4103186.27 4103186.27 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.59 79.92% 46305.01 44469 49460 46305.20 44764 48214 2712836 2712836 0.00
crit 14.72 20.08% 94458.39 90716 100898 94455.47 0 100898 1390350 1390350 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 83445 (158064) 6.5% (12.3%) 73.2 4.02sec 647732 482722 Direct 73.2 248392 714500 341952 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.21 73.21 0.00 0.00 1.3418 0.0000 25032968.94 25032968.94 0.00 482722.27 482722.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.51 79.93% 248391.87 159755 586370 249621.93 203151 350931 14533684 14533684 0.00
crit 14.69 20.07% 714500.50 458817 1684055 718128.58 458817 1557750 10499285 10499285 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74620 5.8% 75.8 5.02sec 295381 0 Direct 75.8 214734 617426 295390 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.78 75.78 0.00 0.00 0.0000 0.0000 22385321.98 22385321.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.61 79.97% 214733.63 134194 492551 215447.31 158730 308977 13014102 13014102 0.00
crit 15.18 20.03% 617426.34 385407 1414606 619470.39 404385 1141949 9371220 9371220 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (54262) 0.0% (4.2%) 3.0 120.44sec 5425852 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 271292.60 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 17729 1.4% 36.1 7.36sec 147267 0 Direct 36.1 121869 248614 147261 20.0%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.11 36.11 0.00 0.00 0.0000 0.0000 5318310.61 5318310.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.88 79.96% 121869.49 121869 121869 121869.49 121869 121869 3519230 3519230 0.00
crit 7.24 20.04% 248613.77 248614 248614 248524.26 0 248614 1799081 1799081 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 36533 2.9% 91.9 2.86sec 119220 0 Direct 91.9 98655 201256 119217 20.0%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.92 91.92 0.00 0.00 0.0000 0.0000 10959245.42 10959245.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.50 79.96% 98654.92 98655 98655 98654.92 98655 98655 7251091 7251091 0.00
crit 18.43 20.04% 201256.04 201256 201256 201256.04 201256 201256 3708154 3708154 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 246354 / 164436
Fire Blast 212874 11.1% 91.2 3.24sec 467303 234183 Direct 91.2 389081 778140 467307 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.23 91.23 0.00 0.00 1.9955 0.0000 42630714.47 42630714.47 0.00 234183.23 234183.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.89 79.89% 389081.41 370953 412592 389111.53 381077 399868 28358414 28358414 0.00
crit 18.34 20.11% 778139.86 741905 825185 778198.52 745108 813084 14272301 14272301 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33480 1.7% 10.3 30.61sec 650813 463268 Direct 10.3 115100 230224 138093 20.0%  
Periodic 106.3 41371 82779 49676 20.1% 68.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.30 10.30 106.28 106.28 1.4049 1.9404 6701634.41 6701634.41 0.00 30366.60 463267.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.24 80.02% 115100.36 109912 122250 115107.30 110703 120894 948441 948441 0.00
crit 2.06 19.98% 230224.38 219824 244499 206731.55 0 244499 473626 473626 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.0 79.94% 41371.37 21 45844 41373.85 39931 42995 3514876 3514876 0.00
crit 21.3 20.06% 82778.58 42 91687 82783.11 67368 89730 1764692 1764692 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177668 / 23691
Lightning Blast 177668 1.8% 37.2 7.00sec 191166 187122 Direct 37.2 159022 318137 191171 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.18 37.18 0.00 0.00 1.0216 0.0000 7106701.79 7106701.79 0.00 187121.88 187121.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.67 79.80% 159021.75 152655 169791 159021.23 154453 166119 4717364 4717364 0.00
crit 7.51 20.20% 318137.45 305311 339582 318077.76 0 339582 2389338 2389338 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Sentinel
Ascendance 2.0 185.64sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 99.58sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 1.0864 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8771 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.48sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.6sec 49.6sec 27.78% 48.13% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.78%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.29% 32.29% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.3 50.5 4.5sec 2.5sec 66.73% 71.54% 50.5(58.2) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.99%
  • elemental_focus_2:37.73%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.0 0.7 13.8sec 13.3sec 8.03% 23.33% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.03%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.7sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.7sec 19.1sec 38.27% 34.29% 6.3(17.5) 0.7

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.19%
  • power_of_the_maelstrom_2:6.14%
  • power_of_the_maelstrom_3:25.94%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 94.0sec 94.0sec 25.55% 25.55% 40.2(40.2) 3.1

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:13.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.21% 11.29% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.15%
  • stormkeeper_2:3.05%
  • stormkeeper_3:4.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 99.05% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.7 13.3sec
Lava Surge: Wasted 0.8 83.6sec
Lava Surge: During Lava Burst 7.8 34.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6650.0007.5322.2550.00013.306
Fire Elemental0.4100.0011.4810.5900.0003.718
Ascendance5.7490.003100.7335.6710.000100.733
Lava Burst0.7940.00012.2875.2940.00021.622

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Sentinel
earth_shock Maelstrom 51.6 5234.1 101.4 101.4 16271.4
flame_shock Maelstrom 11.3 207.6 18.3 18.3 180763.1
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.60 1154.56 (21.00%) 11.71 28.59 2.42%
Lava Burst Overload Maelstrom 59.05 504.19 (9.17%) 8.54 27.23 5.12%
Lightning Bolt Maelstrom 73.20 585.63 (10.65%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 75.78 451.50 (8.21%) 5.96 3.19 0.70%
Aftershock Maelstrom 62.96 1632.54 (29.69%) 25.93 0.00 0.00%
Resonance Totem Maelstrom 298.59 290.54 (5.28%) 0.97 8.05 2.70%
The Deceiver's Blood Pact Maelstrom 10.31 878.93 (15.99%) 85.29 165.86 15.87%
Resource RPS-Gain RPS-Loss
Maelstrom 18.33 18.14
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.09 9.10 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Charm + Sentinel Damage Per Second
Count 24999
Mean 1281183.17
Minimum 1033736.00
Maximum 1575502.75
Spread ( max - min ) 541766.75
Range [ ( max - min ) / 2 * 100% ] 21.14%
Standard Deviation 68998.6607
5th Percentile 1170621.27
95th Percentile 1397633.28
( 95th Percentile - 5th Percentile ) 227012.00
Mean Distribution
Standard Deviation 436.3946
95.00% Confidence Intervall ( 1280327.86 - 1282038.49 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11142
0.1 Scale Factor Error with Delta=300 40641057
0.05 Scale Factor Error with Delta=300 162564227
0.01 Scale Factor Error with Delta=300 4064105656
Priority Target DPS
Sample Data Charm + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1281183.17
Minimum 1033736.00
Maximum 1575502.75
Spread ( max - min ) 541766.75
Range [ ( max - min ) / 2 * 100% ] 21.14%
Standard Deviation 68998.6607
5th Percentile 1170621.27
95th Percentile 1397633.28
( 95th Percentile - 5th Percentile ) 227012.00
Mean Distribution
Standard Deviation 436.3946
95.00% Confidence Intervall ( 1280327.86 - 1282038.49 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 112
0.1% Error 11142
0.1 Scale Factor Error with Delta=300 40641057
0.05 Scale Factor Error with Delta=300 162564227
0.01 Scale Factor Error with Delta=300 4064105656
DPS(e)
Sample Data Charm + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1281183.17
Minimum 1033736.00
Maximum 1575502.75
Spread ( max - min ) 541766.75
Range [ ( max - min ) / 2 * 100% ] 21.14%
Damage
Sample Data Charm + Sentinel Damage
Count 24999
Mean 327915363.86
Minimum 259520614.68
Maximum 409556258.91
Spread ( max - min ) 150035644.23
Range [ ( max - min ) / 2 * 100% ] 22.88%
DTPS
Sample Data Charm + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.96 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 7.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.52 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.99 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.41 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.88 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.75 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.64 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.56 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 48.62 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLIILLLLLIIIILALLNPPPNQQLNQMQQQQLNQQQQLNQQQLNQQJQQLKIMPPLLNQQQLNQQQNLQQALNMQLQLN97QLQQNQOQLNQLPPLJKIIKKLLMNQQQLLNIAQQLLNPPLLLMNPQLNQQQQLLIQQLNLHQQAJQLNQQFLLLLILLLLLIL9LNPMPLLNPQQNLOQQQNLPPNLIIILPMNJKKLNNLQLNQQQQALNQQQLLLIILLGLLLAILLLLIIILLLLLI

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.956 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:03.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
0:04.190 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.004 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.817 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(5)
0:06.621 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(6)
0:07.415 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
0:07.415 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
0:08.460 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
0:09.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(9)
0:10.477 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.3/125: 85% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:11.468 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:12.222 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:12.979 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:13.969 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:14.730 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:15.739 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:16.747 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.738 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.492 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.245 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.999 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.753 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.743 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:21.743 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.863 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.980 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:24.821 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:25.938 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.078 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:28.218 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:29.073 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:30.214 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:31.353 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:32.492 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:33.346 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:34.486 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.341 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.481 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.619 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.758 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.896 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.036 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.147 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.627 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.109 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.3/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.590 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.3/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.071 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.551 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.3/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.663 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.144 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.4/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.624 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.4/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.104 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.586 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.4/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.700 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.3/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.180 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.631 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.720 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.809 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.900 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:05.351 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.440 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:07.530 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.642 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.123 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.605 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.2/125: 45% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.717 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.2/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.197 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.308 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.7/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.788 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.269 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.749 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:21.201 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.7/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:22.289 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:23.740 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.190 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.642 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.755 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.5/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:29.236 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:30.717 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.198 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:32.198 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
1:33.297 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
1:34.380 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
1:35.449 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.6/125: 14% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
1:36.857 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.6/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(5)
1:38.247 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
1:39.607 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
1:40.616 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
1:41.612 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
1:42.599 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
1:42.599 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:43.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:45.221 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:46.532 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:47.843 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:48.828 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:50.141 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:50.898 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:52.185 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:53.474 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:54.562 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.6/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.013 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.6/125: 25% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.126 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.607 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.6/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.6/125: 68% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.569 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 104.6/125: 84% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.827 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 105.6/125: 84% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.936 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.047 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.160 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.271 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.383 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.494 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.976 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:12.064 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.154 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.605 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.057 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:18.987 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.4/125: 69% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:20.077 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.4/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:21.168 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:22.257 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:22.257 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:23.709 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:25.191 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:26.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:27.781 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.892 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:30.374 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.853 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.964 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:34.446 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:35.557 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:36.670 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.0/125: 82% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:37.781 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:39.234 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:40.684 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.9/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:42.136 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:43.226 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.2/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:44.677 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.130 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.582 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.2/125: 49% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.034 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.123 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.2/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.603 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.2/125: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.716 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.196 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.676 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.787 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.899 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.382 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.471 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.8/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:01.923 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.8/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.374 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.374 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides
3:04.449 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(2)
3:05.511 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(3)
3:06.910 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
3:07.944 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(5)
3:08.967 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.2/125: 32% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
3:09.979 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
3:09.979 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
3:11.336 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
3:12.678 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.2/125: 73% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:13.990 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:15.302 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:16.288 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:17.599 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:18.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:20.199 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:21.487 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:22.777 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:23.744 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.196 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.285 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.736 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.825 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.276 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.365 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.844 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.955 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.6/125: 63% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.434 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.6/125: 74% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.546 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.026 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.505 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.2/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.986 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.2/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.075 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.526 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:44.280 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.732 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:47.183 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.634 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.8/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.745 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.225 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.675 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.127 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.217 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.308 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:57.398 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.509 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.622 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.102 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.582 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.691 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.803 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 22.5/125: 18% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.915 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.027 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.138 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.620 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.733 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.2/125: 83% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.843 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.955 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.518 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.608 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.061 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.514 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.995 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.474 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 74.2/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.474 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.2/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.926 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.2/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.015 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.467 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:27.919 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:30.462 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.4/125: 80% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.913 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.4/125: 92% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.004 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.115 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.225 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.705 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.186 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.299 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.778 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.230 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.680 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.680 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides
4:44.754 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(2)
4:46.170 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(3)
4:47.568 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
4:48.949 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:50.323 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:51.343 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
4:52.351 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
4:53.347 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:54.330 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:55.640 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:56.951 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:58.262 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:59.574 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Terror : 1285369 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1285369.1 1285369.1 881.8 / 0.069% 278281.8 / 21.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Terror 1285369
Earth Shock 289132 22.5% 50.5 5.78sec 1716816 1646956 Direct 50.5 1195028 3428708 1716909 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.52 50.52 0.00 0.00 1.0424 0.0000 86738603.96 86738603.96 0.00 1646956.37 1646956.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.72 76.64% 1195027.65 741258 1619485 1194642.90 1002469 1392032 46270542 46270542 0.00
crit 11.80 23.36% 3428707.99 2128892 4651160 3427123.32 2416496 4401629 40468062 40468062 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 127057 9.9% 11.3 27.12sec 3365103 3267448 Direct 11.3 90092 262675 219678 75.1%  
Periodic 217.7 49647 198307 163645 76.7% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 217.73 217.73 1.0300 1.3693 38118049.25 38118049.25 0.00 123038.05 3267448.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.82 24.92% 90092.32 80604 98617 89324.88 0 98617 254294 254294 0.00
crit 8.50 75.08% 262675.41 231494 283227 262737.79 251084 274438 2234021 2234021 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.8 23.32% 49646.89 270 54240 49655.57 46171 51744 2520534 2520534 0.00
crit 167.0 76.68% 198307.23 145 218089 198320.38 190488 205759 33109200 33109200 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 315010 (460527) 24.5% (35.8%) 98.6 3.01sec 1401501 1101866 Direct 98.4 0 960623 960623 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.58 98.38 0.00 0.00 1.2719 0.0000 94501538.53 94501538.53 0.00 1101865.55 1101865.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.38 100.00% 960622.79 763198 1168080 959073.45 888804 1026483 94501539 94501539 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 131468 10.2% 51.6 5.66sec 763620 0 Direct 51.5 0 765637 765637 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.65 51.51 0.00 0.00 0.0000 0.0000 39440110.87 39440110.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.51 100.00% 765637.49 608227 930895 764409.59 695993 836447 39440111 39440111 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14049 1.1% 73.2 3.83sec 57540 0 Direct 73.2 46305 94457 57541 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.25 73.25 0.00 0.00 0.0000 0.0000 4214660.66 4214660.66 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.16 76.67% 46304.72 44469 49460 46304.25 44853 48197 2600364 2600364 0.00
crit 17.09 23.33% 94457.48 90716 100898 94455.60 90716 100898 1614296 1614296 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 88274 (161616) 6.9% (12.6%) 74.4 3.95sec 651612 486456 Direct 74.4 247885 711567 355916 23.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.41 74.41 0.00 0.00 1.3395 0.0000 26481726.78 26481726.78 0.00 486456.37 486456.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.07 76.70% 247884.80 159755 586370 249095.47 186965 337717 14146803 14146803 0.00
crit 17.34 23.30% 711566.58 458817 1684055 714368.36 479985 1330129 12334924 12334924 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73341 5.7% 71.2 5.27sec 308869 0 Direct 71.2 214599 618184 308864 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.23 71.23 0.00 0.00 0.0000 0.0000 22001920.03 22001920.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.59 76.64% 214598.96 134194 492551 215248.09 152048 311094 11715833 11715833 0.00
crit 16.64 23.36% 618184.24 385407 1414606 620021.03 407971 1168767 10286087 10286087 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 51072 4.0% 10.0 28.67sec 1536509 0 Direct 10.0 1233906 2517168 1536549 23.6%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.97 9.97 0.00 0.00 0.0000 0.0000 15321392.35 15321392.35 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.62 76.42% 1233905.72 1233906 1233906 1233856.36 0 1233906 9402590 9402590 0.00
crit 2.35 23.58% 2517167.67 2517168 2517168 2298366.70 0 2517168 5918803 5918803 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 253010 / 171644
Fire Blast 218723 11.5% 92.8 3.19sec 479682 240511 Direct 92.8 388885 777822 479675 23.3%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.81 92.81 0.00 0.00 1.9944 0.0000 44519375.54 44519375.54 0.00 240511.37 240511.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.14 76.66% 388884.64 370953 412592 388915.46 380255 400975 27666696 27666696 0.00
crit 21.67 23.34% 777822.43 741905 825185 777872.47 752582 812906 16852680 16852680 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34286 1.8% 10.4 30.25sec 669037 476812 Direct 10.4 115059 230102 141908 23.3%  
Periodic 107.8 41332 82657 50965 23.3% 69.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.43 10.43 107.83 107.83 1.4032 1.9377 6975285.55 6975285.55 0.00 31198.86 476812.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.99 76.65% 115059.13 109912 122250 115065.03 109912 122250 919532 919532 0.00
crit 2.43 23.35% 230102.33 219824 244499 214982.35 0 244499 560080 560080 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.7 76.69% 41331.81 21 45844 41335.20 39932 43310 3417962 3417962 0.00
crit 25.1 23.31% 82657.35 42 91687 82660.55 71558 89043 2077711 2077711 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182394 / 24321
Lightning Blast 182394 1.9% 37.2 7.00sec 196270 192115 Direct 37.2 158998 318037 196276 23.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.17 0.00 0.00 1.0216 0.0000 7295741.99 7295741.99 0.00 192114.55 192114.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.46 76.57% 158998.41 152655 169791 158999.28 154375 166260 4525267 4525267 0.00
crit 8.71 23.43% 318037.16 305311 339582 318032.19 0 339582 2770475 2770475 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Terror
Ascendance 2.0 185.27sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 98.26sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.98 0.00 0.00 0.00 1.0830 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.63sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8770 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.48sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.1sec 50.1sec 27.33% 47.92% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.18% 32.18% 3.0(3.0) 8.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.18%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 68.0 53.3 4.4sec 2.5sec 68.56% 72.91% 53.3(61.9) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.29%
  • elemental_focus_2:39.27%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.0 0.7 13.7sec 13.2sec 8.02% 23.43% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.02%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.99% 29.99% 4.2(4.2) 12.6

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.0sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.5sec 19.1sec 38.05% 33.91% 6.3(17.4) 0.6

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.14%
  • power_of_the_maelstrom_2:6.18%
  • power_of_the_maelstrom_3:25.73%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.12% 11.11% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.14%
  • stormkeeper_2:3.04%
  • stormkeeper_3:3.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 99.20% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.8 13.2sec
Lava Surge: Wasted 0.8 83.7sec
Lava Surge: During Lava Burst 7.8 34.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6630.0009.2742.2520.00010.210
Fire Elemental0.4300.0011.4820.6470.0003.737
Ascendance5.6180.00170.6595.5490.00070.659
Lava Burst0.8010.0009.8895.3630.00023.607

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Terror
earth_shock Maelstrom 50.5 5098.3 100.9 100.9 17013.4
flame_shock Maelstrom 11.3 207.5 18.3 18.3 183657.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.58 1156.42 (21.57%) 11.73 26.57 2.25%
Lava Burst Overload Maelstrom 51.65 441.87 (8.24%) 8.55 23.00 4.95%
Lightning Bolt Maelstrom 74.40 595.21 (11.10%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 71.24 424.59 (7.92%) 5.96 2.83 0.66%
Aftershock Maelstrom 61.85 1591.74 (29.68%) 25.74 0.00 0.00%
Resonance Totem Maelstrom 298.59 290.98 (5.43%) 0.97 7.61 2.55%
The Deceiver's Blood Pact Maelstrom 10.11 861.38 (16.06%) 85.18 158.99 15.58%
Resource RPS-Gain RPS-Loss
Maelstrom 17.87 17.69
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 57.08 13.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Charm + Terror Damage Per Second
Count 24999
Mean 1285369.10
Minimum 1009753.41
Maximum 1570811.10
Spread ( max - min ) 561057.70
Range [ ( max - min ) / 2 * 100% ] 21.82%
Standard Deviation 71134.4246
5th Percentile 1172275.96
95th Percentile 1405319.53
( 95th Percentile - 5th Percentile ) 233043.57
Mean Distribution
Standard Deviation 449.9026
95.00% Confidence Intervall ( 1284487.30 - 1286250.89 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11766
0.1 Scale Factor Error with Delta=300 43195979
0.05 Scale Factor Error with Delta=300 172783914
0.01 Scale Factor Error with Delta=300 4319597831
Priority Target DPS
Sample Data Charm + Terror Priority Target Damage Per Second
Count 24999
Mean 1285369.10
Minimum 1009753.41
Maximum 1570811.10
Spread ( max - min ) 561057.70
Range [ ( max - min ) / 2 * 100% ] 21.82%
Standard Deviation 71134.4246
5th Percentile 1172275.96
95th Percentile 1405319.53
( 95th Percentile - 5th Percentile ) 233043.57
Mean Distribution
Standard Deviation 449.9026
95.00% Confidence Intervall ( 1284487.30 - 1286250.89 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 118
0.1% Error 11766
0.1 Scale Factor Error with Delta=300 43195979
0.05 Scale Factor Error with Delta=300 172783914
0.01 Scale Factor Error with Delta=300 4319597831
DPS(e)
Sample Data Charm + Terror Damage Per Second (Effective)
Count 24999
Mean 1285369.10
Minimum 1009753.41
Maximum 1570811.10
Spread ( max - min ) 561057.70
Range [ ( max - min ) / 2 * 100% ] 21.82%
Damage
Sample Data Charm + Terror Damage
Count 24999
Mean 326818002.43
Minimum 249459326.99
Maximum 403624211.19
Spread ( max - min ) 154164884.20
Range [ ( max - min ) / 2 * 100% ] 23.59%
DTPS
Sample Data Charm + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.98 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.04 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.37 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.88 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.82 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.49 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.73 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 49.66 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLILLLLILLLLLILLNPPPQNQLQMLNPLPLLNPPLNLILQQNLQQJNQQLKMNLNLLLLLIL97LPNLPPLALNMPQQLNLPLNNLPPNLIOLQNQQJLQMQLNILLQNLLLLLLILLNPPPMLNQQQQLNIIQQLNQQQHLL9AJNIQQLQFLLILLLLLIIILLLNMPPPLNQQQQLNOQQQLNQQQQLNMQJQQLNQQQNLQQQNQLLQNQLMLALNQQQLLNPPPNI9IILLLLIL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:03.082 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:04.171 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:04.971 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.769 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.559 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.338 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:07.338 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:08.365 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
0:09.379 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.3/125: 72% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.400 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:11.410 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.167 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.186 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:15.177 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.167 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.921 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.676 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.6/125: 53% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.668 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.422 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.6/125: 74% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.412 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.6/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:21.422 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.279 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.555 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.410 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.550 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.693 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.832 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.971 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.829 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.1/125: 34% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.107 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.247 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.102 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.956 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.812 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.4/125: 18% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.952 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.4/125: 25% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.806 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.4/125: 52% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.946 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.802 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.4/125: 80% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.942 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.4/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.052 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.0/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.534 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.014 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.124 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.236 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.716 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.827 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.939 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.420 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:54.870 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:55.958 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.409 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.860 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.311 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.400 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.3/125: 60% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.491 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.581 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.8/125: 33% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:06.120 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.209 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.320 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.433 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.4/125: 76% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.546 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.4/125: 87% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.659 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.8/125: 27% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.139 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.619 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:16.070 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.8/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.521 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.8/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:18.975 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.064 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.515 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.629 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.109 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.589 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:26.701 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:27.813 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:29.293 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.0/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:30.775 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:31.864 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:31.864 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides
1:33.296 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
1:34.357 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 44.8/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
1:35.408 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
1:36.790 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(5)
1:38.182 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.8/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(7)
1:39.540 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(8)
1:40.882 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.8/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:41.866 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:42.850 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:44.161 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:45.144 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:46.130 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.7/125: 92% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:47.114 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:48.425 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
1:49.737 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:51.025 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:51.992 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.6/125: 88% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:53.082 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.170 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.925 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.376 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.856 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.970 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.5/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.449 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.930 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.042 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.523 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.636 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.747 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.858 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.970 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:10.083 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.195 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.305 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.786 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:14.898 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.010 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.491 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.4/125: 32% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.453 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.933 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.414 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.4/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.894 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.006 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.487 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.967 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.079 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.560 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.011 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.463 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.7/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:35.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.008 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.7/125: 73% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:38.118 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.600 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.081 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:42.531 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:43.983 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:45.434 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:46.522 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:47.612 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.724 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.204 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.685 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.165 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.278 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.759 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:57.239 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.719 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.809 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.897 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:02.349 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:03.438 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:03.438 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides
3:04.513 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(2)
3:05.576 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(3)
3:06.625 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(4)
3:07.664 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(5)
3:08.690 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
3:10.038 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
3:11.039 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(8)
3:11.039 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(8)
3:12.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
3:13.686 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:14.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:15.981 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:17.291 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:18.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:19.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:21.228 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:22.214 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:23.198 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:24.183 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.294 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:26.776 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.256 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.368 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.6/125: 22% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.480 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.6/125: 12% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.961 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.440 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.892 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.6/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.344 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.6/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.433 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.2/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.884 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.335 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.2/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.815 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.266 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.2/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:44.718 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.2/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.808 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.564 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.016 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:49.468 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.919 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:52.370 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.482 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.963 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.444 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.923 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.402 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.855 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.4/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:01.944 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.034 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 19.6/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:04.486 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.598 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.6/125: 24% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.709 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.819 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.299 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.409 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.520 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.001 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.480 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:15.591 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.1/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:17.044 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:18.495 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:19.947 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:21.399 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:22.489 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.4/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:23.942 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:25.030 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.482 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.934 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.045 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.5/125: 24% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.527 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.639 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.750 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.862 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.862 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
4:35.324 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
4:36.407 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
4:37.831 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.0/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(4)
4:39.211 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(6)
4:40.560 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(7)
4:41.561 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(8)
4:42.877 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.0/125: 75% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:43.845 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:45.157 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:46.443 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:47.729 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.2/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:48.696 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:49.663 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:50.631 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:51.599 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
4:52.568 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:53.856 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
4:54.824 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.275 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.726 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.838 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Thurible : 1262503 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1262502.7 1262502.7 872.1 / 0.069% 275687.6 / 21.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Thurible 1262503
Earth Shock 283980 22.5% 50.5 5.78sec 1686480 1617798 Direct 50.5 1225058 3519160 1686446 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.52 50.52 0.00 0.00 1.0425 0.0000 85193222.72 85193222.72 0.00 1617797.62 1617797.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.36 79.89% 1225058.36 760779 1662133 1224561.92 1047840 1429392 49437872 49437872 0.00
crit 10.16 20.11% 3519160.09 2184956 4773647 3517620.91 2392823 4613058 35755351 35755351 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128575 10.2% 11.3 27.11sec 3407685 3308750 Direct 11.3 92393 269710 222457 73.4%  
Periodic 217.7 50925 204079 165601 74.9% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 217.73 217.73 1.0300 1.3693 38573404.91 38573404.91 0.00 124512.28 3308749.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.02 26.65% 92393.06 82726 101214 91950.82 0 101214 278702 278702 0.00
crit 8.30 73.35% 269710.14 237590 290685 269773.52 255539 281665 2239419 2239419 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.7 25.12% 50925.47 37 55668 50934.79 47586 52908 2785773 2785773 0.00
crit 163.0 74.88% 204079.40 284 223832 204096.31 194317 211821 33269511 33269511 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 318498 (465739) 25.2% (36.9%) 98.7 2.99sec 1416038 1113176 Direct 98.5 0 970352 970352 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.67 98.47 0.00 0.00 1.2721 0.0000 95547836.30 95547836.30 0.00 1113176.39 1113176.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.47 100.00% 970351.90 783297 1167216 968932.75 901091 1031044 95547836 95547836 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 133180 10.5% 51.8 5.67sec 771360 0 Direct 51.7 0 773339 773339 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.80 51.66 0.00 0.00 0.0000 0.0000 39953126.48 39953126.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.66 100.00% 773339.01 624244 930206 772223.72 706805 835623 39953126 39953126 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14061 1.1% 73.5 3.75sec 57421 0 Direct 73.5 47531 96958 57422 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.46 73.46 0.00 0.00 0.0000 0.0000 4218258.01 4218258.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.76 79.99% 47530.65 45640 50762 47530.47 46046 49633 2793068 2793068 0.00
crit 14.70 20.01% 96958.48 93105 103555 96955.66 93105 103555 1425190 1425190 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 86670 (158611) 6.9% (12.6%) 74.3 3.99sec 640062 477775 Direct 74.3 253741 731818 349752 20.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.34 74.34 0.00 0.00 1.3397 0.0000 26000589.90 26000589.90 0.00 477775.02 477775.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.41 79.92% 253741.10 163962 601812 254992.90 208416 343811 15075339 15075339 0.00
crit 14.93 20.08% 731817.74 470900 1728404 734908.17 485325 1483335 10925250 10925250 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 71941 5.7% 71.2 5.31sec 303057 0 Direct 71.2 219847 632764 303059 20.2%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.21 71.21 0.00 0.00 0.0000 0.0000 21581979.65 21581979.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.86 79.85% 219846.69 137728 505522 220536.19 162381 324662 12501463 12501463 0.00
crit 14.35 20.15% 632764.25 395556 1451859 635202.88 0 1281921 9080517 9080517 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 32328 2.6% 16.6 17.83sec 584523 0 Direct 16.4 487076 993635 589808 20.3%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.59 16.44 0.00 0.00 0.0000 0.0000 9698139.20 9698139.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.11 79.72% 487076.02 487076 487076 487076.02 487076 487076 6384750 6384750 0.00
crit 3.33 20.28% 993635.07 993635 993635 964262.04 0 993635 3313389 3313389 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 252854 / 168983
Fire Blast 218518 11.6% 91.4 3.23sec 479461 240463 Direct 91.4 399328 798694 479467 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.38 91.38 0.00 0.00 1.9939 0.0000 43814561.41 43814561.41 0.00 240463.21 240463.21
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.05 79.94% 399328.48 380721 423458 399362.18 390584 410830 29169778 29169778 0.00
crit 18.34 20.06% 798693.72 761443 846916 798759.91 768748 831136 14644784 14644784 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34336 1.8% 10.3 30.59sec 668860 476876 Direct 10.3 118143 236218 141826 20.1%  
Periodic 106.4 42436 84866 50940 20.0% 68.7%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.29 10.29 106.44 106.44 1.4026 1.9377 6881321.72 6881321.72 0.00 31182.64 476876.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.22 79.94% 118142.52 112806 125469 118153.62 113780 124251 971653 971653 0.00
crit 2.06 20.06% 236218.26 225613 250938 211943.79 0 250938 487497 487497 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.1 79.96% 42436.45 22 47051 42440.23 40905 44312 3611750 3611750 0.00
crit 21.3 20.04% 84866.44 43 94102 84866.11 63333 91813 1810421 1810421 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182132 / 24286
Lightning Blast 182132 1.9% 37.2 7.01sec 195999 191834 Direct 37.2 163208 326476 195997 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.17 37.17 0.00 0.00 1.0217 0.0000 7285266.04 7285266.04 0.00 191833.64 191833.64
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.70 79.92% 163208.22 156675 174263 163209.92 158429 170624 4848073 4848073 0.00
crit 7.47 20.08% 326476.28 313351 348525 326370.94 0 348525 2437194 2437194 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Thurible
Ascendance 2.0 185.66sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 99.29sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 1.0789 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Thurible
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8771 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.75sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 50.0sec 50.0sec 27.42% 47.95% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.30% 32.30% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.0 51.0 4.5sec 2.5sec 66.70% 71.37% 51.0(58.7) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.98%
  • elemental_focus_2:37.72%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.0 0.7 13.7sec 13.2sec 8.03% 23.45% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.03%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.6sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.5sec 19.0sec 38.13% 33.94% 6.3(17.5) 0.7

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.17%
  • power_of_the_maelstrom_3:25.80%

Trigger Attempt Success

  • trigger_pct:15.04%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Spear of Anguish 16.6 0.0 17.9sec 17.9sec 16.52% 16.52% 0.0(0.0) 16.4

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.15% 11.11% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.13%
  • stormkeeper_2:3.04%
  • stormkeeper_3:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 99.15% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Thurible
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.8 13.2sec
Lava Surge: Wasted 0.8 85.4sec
Lava Surge: During Lava Burst 7.8 34.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6620.0009.5932.2480.00011.046
Fire Elemental0.4120.0011.4800.5940.0003.718
Ascendance5.6990.00169.6185.6190.00069.618
Lava Burst0.8010.00010.0105.3550.00021.976

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Thurible
earth_shock Maelstrom 50.5 5097.6 100.9 100.9 16712.6
flame_shock Maelstrom 11.3 207.4 18.3 18.3 185996.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.67 1157.46 (21.59%) 11.73 26.57 2.24%
Lava Burst Overload Maelstrom 51.79 443.23 (8.27%) 8.56 22.91 4.92%
Lightning Bolt Maelstrom 74.34 594.73 (11.09%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 71.21 424.44 (7.92%) 5.96 2.84 0.66%
Aftershock Maelstrom 61.83 1591.48 (29.69%) 25.74 0.00 0.00%
Resonance Totem Maelstrom 298.59 291.02 (5.43%) 0.97 7.56 2.53%
The Deceiver's Blood Pact Maelstrom 10.08 858.80 (16.02%) 85.17 158.77 15.60%
Resource RPS-Gain RPS-Loss
Maelstrom 17.87 17.68
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.37 9.50 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Thurible Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Charm + Thurible Damage Per Second
Count 24999
Mean 1262502.69
Minimum 1038661.23
Maximum 1567536.40
Spread ( max - min ) 528875.17
Range [ ( max - min ) / 2 * 100% ] 20.95%
Standard Deviation 70356.4822
5th Percentile 1149169.23
95th Percentile 1381013.00
( 95th Percentile - 5th Percentile ) 231843.77
Mean Distribution
Standard Deviation 444.9824
95.00% Confidence Intervall ( 1261630.54 - 1263374.84 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11930
0.1 Scale Factor Error with Delta=300 42256343
0.05 Scale Factor Error with Delta=300 169025370
0.01 Scale Factor Error with Delta=300 4225634230
Priority Target DPS
Sample Data Charm + Thurible Priority Target Damage Per Second
Count 24999
Mean 1262502.69
Minimum 1038661.23
Maximum 1567536.40
Spread ( max - min ) 528875.17
Range [ ( max - min ) / 2 * 100% ] 20.95%
Standard Deviation 70356.4822
5th Percentile 1149169.23
95th Percentile 1381013.00
( 95th Percentile - 5th Percentile ) 231843.77
Mean Distribution
Standard Deviation 444.9824
95.00% Confidence Intervall ( 1261630.54 - 1263374.84 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 120
0.1% Error 11930
0.1 Scale Factor Error with Delta=300 42256343
0.05 Scale Factor Error with Delta=300 169025370
0.01 Scale Factor Error with Delta=300 4225634230
DPS(e)
Sample Data Charm + Thurible Damage Per Second (Effective)
Count 24999
Mean 1262502.69
Minimum 1038661.23
Maximum 1567536.40
Spread ( max - min ) 528875.17
Range [ ( max - min ) / 2 * 100% ] 20.95%
Damage
Sample Data Charm + Thurible Damage
Count 24999
Mean 320766557.17
Minimum 256771081.96
Maximum 404142115.68
Spread ( max - min ) 147371033.73
Range [ ( max - min ) / 2 * 100% ] 22.97%
DTPS
Sample Data Charm + Thurible Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Thurible Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Thurible Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Thurible Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Thurible Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Thurible Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + ThuribleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Thurible Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.96 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.04 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.37 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.96 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.79 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.48 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.73 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 49.60 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLKHKKLFLLLILLLLIILLLLLILLNPPPQNQLLMNPPPNNLLQNLQLNNQQQLNQJQQNLLMQQNQLQQNNQLQNQQ97LAQNMQLLQLNILLLLLLIILLNNOQQJLMQLKKILPQNQQLNNPPPLNQQQLNMQQLQLNPPPLNILLLHLLALJKIK9KLFLLILLLLIIIIILLLLLILLMLNLLLLLLILLONNLPPLNMPJQLKKLILPLNQQLNLQQQNQLAQMQQNLL9QQNQLQNQQQLNNM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.958 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides
0:03.082 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(2)
0:03.916 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(3)
0:04.739 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.3/125: 12% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(4)
0:05.554 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(5)
0:06.357 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(6)
0:07.413 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(7)
0:07.413 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(7)
0:08.460 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(8)
0:09.494 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(9)
0:10.517 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.275 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:12.284 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:13.292 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:14.302 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:15.312 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:16.071 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.826 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.817 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.798 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.788 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.779 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:22.618 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:23.736 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:24.854 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:25.694 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:26.810 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.949 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:29.088 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:30.230 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:31.067 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.182 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.020 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:34.138 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:34.976 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:35.815 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:36.934 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:38.073 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.1/125: 45% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.212 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.067 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.4/125: 80% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.922 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:42.062 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:43.174 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:44.655 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.742 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.832 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.285 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.736 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.847 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.8/125: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.959 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.441 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:54.920 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:56.400 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:57.880 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.6/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.991 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.5/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.470 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.557 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:02.646 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.737 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.825 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.5/125: 18% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.914 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.366 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.5/125: 47% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.478 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.591 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.071 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.183 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.2/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.664 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.2/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.145 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.625 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.104 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.2/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:19.216 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:20.328 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.808 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.288 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.0/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:24.769 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:25.881 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.6/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:27.363 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:28.843 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.954 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:29.954 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:31.435 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:31.435 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides
1:32.898 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.6/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(2)
1:33.981 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power, rising_tides(3)
1:35.051 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.5/125: 12% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
1:36.432 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
1:37.457 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
1:38.791 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
1:40.108 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(9)
1:41.086 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:42.054 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:43.020 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:44.330 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power, rising_tides(10)
1:45.642 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:46.954 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:48.265 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:49.250 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.5/125: 91% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:50.561 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:51.545 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.105 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.555 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.644 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:57.733 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.487 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.968 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.418 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:02.645 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:04.096 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.185 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.296 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.407 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 88.8/125: 71% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.517 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 109.8/125: 88% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.629 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.741 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.220 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.671 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:15.123 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.212 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.664 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.4/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:19.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.596 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.707 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.819 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.9/125: 28% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:24.299 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:25.778 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:27.258 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.9/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.738 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.9/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:29.850 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:31.329 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.808 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:34.290 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.9/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.769 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.9/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.880 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.991 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.1/125: 14% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.470 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:40.951 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:42.061 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:43.543 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.023 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.1/125: 67% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.136 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:47.617 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.098 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.578 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.058 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.170 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.283 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.763 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.241 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.693 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.783 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.875 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.966 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides
3:03.399 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
3:04.483 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 115.5/125: 92% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
3:05.552 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)
3:06.608 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(5)
3:07.653 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(6)
3:08.874 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(7)
3:09.894 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(8)
3:11.234 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:11.234 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:12.546 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:13.859 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:14.844 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
3:16.154 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:17.120 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:18.408 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:19.697 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.1/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:20.662 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, rising_tides(10)
3:21.630 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides(10)
3:22.598 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.710 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:24.824 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.306 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:27.787 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.268 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.750 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.231 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.342 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.824 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.305 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.393 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.844 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:39.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.9/125: 22% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.387 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.838 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.9/125: 43% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:44.290 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:45.739 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.9/125: 72% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:47.221 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.9/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:48.702 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:49.813 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.293 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:52.773 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:53.528 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:54.639 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.750 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.861 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:58.313 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:59.765 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:01.217 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.7/125: 83% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.309 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.422 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:04.904 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:06.015 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:07.126 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.217 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.307 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 94.6/125: 76% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:10.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.6/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.848 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.938 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.050 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.530 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.011 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.122 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.603 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.196 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.308 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.787 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.269 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.1/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.721 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.173 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:30.262 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.712 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:33.164 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 52.6/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.164 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.6/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides
4:34.626 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
4:35.709 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
4:37.134 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)
4:38.541 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:39.573 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:40.931 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
4:41.938 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
4:42.935 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:44.244 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:45.555 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.2/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:46.539 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:47.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:49.160 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:50.472 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:51.457 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:52.769 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
4:54.080 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.562 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.042 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:58.154 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:59.266 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60801 58570 48456 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60801 58570 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Thurible"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=spectral_thurible,id=147018,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=48456
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Charm + Tome : 1281464 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1281464.1 1281464.1 883.1 / 0.069% 279935.1 / 21.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.2 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Charm + Tome 1281464
Earth Shock 294952 23.0% 50.2 5.79sec 1762307 1680883 Direct 50.2 1254772 3591899 1762277 21.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.21 50.21 0.00 0.00 1.0484 0.0000 88485026.97 88485026.97 0.00 1680882.70 1680882.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.31 78.28% 1254772.44 779588 1694776 1254319.27 1071003 1476458 49319730 49319730 0.00
crit 10.90 21.72% 3591898.78 2238977 4867398 3589416.26 2468960 4719190 39165297 39165297 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 131535 10.3% 11.3 27.11sec 3480348 3376541 Direct 11.3 94552 275742 229020 74.2%  
Periodic 216.5 52131 208501 170274 75.6% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.34 11.34 216.50 216.50 1.0308 1.3772 39461630.29 39461630.29 0.00 127352.27 3376540.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.92 25.79% 94551.81 84772 103201 93986.42 0 103201 276443 276443 0.00
crit 8.41 74.21% 275741.91 243464 296394 275803.49 264763 287406 2320286 2320286 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.9 24.45% 52130.82 142 56762 52141.61 49075 54278 2759269 2759269 0.00
crit 163.6 75.55% 208501.32 143 228227 208520.97 200734 215452 34105633 34105633 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14703 1.1% 5.0 63.21sec 882120 0 Periodic 47.0 77649 158363 93843 20.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 47.00 47.00 0.0000 1.2766 4410597.93 4410597.93 0.00 73509.97 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.94% 77649.00 10952 84196 77652.08 72853 84196 2917305 2917305 0.00
crit 9.4 20.06% 158363.50 22343 171760 158381.40 29092 171760 1493293 1493293 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:69081.05
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 326071 (476708) 25.4% (37.2%) 98.3 3.01sec 1455007 1138847 Direct 98.1 0 997391 997391 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 98.29 98.08 0.00 0.00 1.2776 0.0000 97820235.88 97820235.88 0.00 1138847.40 1138847.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.08 100.00% 997391.06 802663 1265454 995809.87 925933 1070367 97820236 97820236 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 136138 10.6% 51.5 5.64sec 792818 0 Direct 51.4 0 794941 794941 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.51 51.38 0.00 0.00 0.0000 0.0000 40840747.53 40840747.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.38 100.00% 794940.99 639678 1008496 793670.25 719652 870064 40840748 40840748 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14499 1.1% 73.2 3.80sec 59453 0 Direct 73.2 48607 99163 59453 21.5%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.16 73.16 0.00 0.00 0.0000 0.0000 4349779.21 4349779.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.47 78.55% 48606.93 46768 51759 48606.76 47210 50552 2793359 2793359 0.00
crit 15.70 21.45% 99163.20 95407 105588 99164.41 95407 104544 1556420 1556420 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 89382 (163510) 7.0% (12.8%) 73.6 4.02sec 666217 493113 Direct 73.6 262216 732910 364195 21.7%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.63 73.63 0.00 0.00 1.3510 0.0000 26814449.15 26814449.15 0.00 493112.71 493112.71
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.68 78.34% 262215.63 168016 613631 263533.12 216843 354738 15123969 15123969 0.00
crit 15.95 21.66% 732910.17 482542 1762348 735917.01 495748 1380951 11690481 11690481 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74128 5.8% 70.6 5.34sec 315052 0 Direct 70.6 226817 634021 315043 21.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.58 70.58 0.00 0.00 0.0000 0.0000 22237937.54 22237937.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.29 78.33% 226817.24 141134 515450 227511.64 163478 343799 12540549 12540549 0.00
crit 15.29 21.67% 634020.78 405336 1480372 636265.49 425322 1173887 9697389 9697389 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 261122 / 175325
Fire Blast 225695 11.8% 91.5 3.23sec 496987 248043 Direct 91.5 408265 816368 496998 21.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 91.48 91.48 0.00 0.00 2.0036 0.0000 45465016.46 45465016.46 0.00 248042.86 248042.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.59 78.26% 408265.14 390134 431774 408293.92 399484 419350 29229147 29229147 0.00
crit 19.89 21.74% 816368.02 780269 863549 816433.64 791916 848601 16235870 16235870 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 35427 1.9% 10.4 30.44sec 688802 486689 Direct 10.4 120771 241478 146483 21.3%  
Periodic 106.4 43412 86861 52794 21.6% 69.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.36 10.36 106.39 106.39 1.4153 1.9469 7133880.96 7133880.96 0.00 32166.04 486688.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.15 78.70% 120771.26 115595 127933 120782.93 115595 127142 984387 984387 0.00
crit 2.21 21.30% 241478.26 231191 255866 220950.07 0 255866 532740 532740 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.4 78.41% 43412.11 22 47975 43414.60 41921 45354 3621313 3621313 0.00
crit 23.0 21.59% 86861.23 44 95950 86864.99 72884 93008 1995442 1995442 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 185473 / 24731
Lightning Blast 185473 1.9% 37.0 7.03sec 200511 193533 Direct 37.0 166923 333970 200521 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0361 0.0000 7418902.61 7418902.61 0.00 193533.22 193533.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.56 79.89% 166922.67 160549 177685 166923.48 162347 174276 4934352 4934352 0.00
crit 7.44 20.11% 333969.72 321098 355370 333866.35 0 355370 2484550 2484550 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Charm + Tome
Ascendance 2.0 186.32sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 98.75sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 1.1042 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Charm + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8640 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.85sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.2sec 50.2sec 27.28% 47.87% 0.0(0.0) 5.7

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.25% 32.25% 3.1(3.1) 8.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.2 51.9 4.5sec 2.5sec 67.69% 72.33% 51.9(60.1) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.09%
  • elemental_focus_2:38.60%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.0 0.0 63.2sec 63.2sec 19.84% 19.84% 0.0(0.0) 4.7

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:19.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.9 0.7 13.8sec 13.3sec 8.01% 23.32% 0.7(0.7) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.01%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.98% 29.98% 4.3(4.3) 12.6

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 81.7sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.5 6.3 34.7sec 19.1sec 37.89% 34.09% 6.3(17.4) 0.6

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.19%
  • power_of_the_maelstrom_2:6.21%
  • power_of_the_maelstrom_3:25.50%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 98.0sec 98.0sec 21.63% 21.63% 33.0(33.0) 3.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.32%
  • rising_tides_2:1.29%
  • rising_tides_3:1.26%
  • rising_tides_4:1.22%
  • rising_tides_5:1.18%
  • rising_tides_6:1.14%
  • rising_tides_7:1.10%
  • rising_tides_8:1.07%
  • rising_tides_9:1.03%
  • rising_tides_10:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 10.23% 11.23% 0.0(0.0) 0.2

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.18%
  • stormkeeper_2:3.06%
  • stormkeeper_3:4.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 98.90% 2.0(2.0) 0.0

Buff details

  • buff initial source:Charm + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.6 13.3sec
Lava Surge: Wasted 0.8 84.9sec
Lava Surge: During Lava Burst 7.8 34.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6590.0017.9272.1710.00010.473
Fire Elemental0.4220.0011.4790.6050.0003.827
Ascendance6.2080.00174.0266.1450.00074.026
Lava Burst0.8020.00010.0095.3830.00023.437

Resources

Resource Usage Type Count Total Average RPE APR
Charm + Tome
earth_shock Maelstrom 50.2 5067.7 100.9 100.9 17460.7
flame_shock Maelstrom 11.3 207.8 18.3 18.3 189930.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 98.29 1152.84 (21.62%) 11.73 26.63 2.26%
Lava Burst Overload Maelstrom 51.51 440.81 (8.27%) 8.56 22.81 4.92%
Lightning Bolt Maelstrom 73.63 589.02 (11.05%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.58 420.69 (7.89%) 5.96 2.80 0.66%
Aftershock Maelstrom 61.55 1582.63 (29.68%) 25.71 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.99 (5.46%) 0.97 7.59 2.54%
The Deceiver's Blood Pact Maelstrom 10.04 854.61 (16.03%) 85.16 158.27 15.63%
Resource RPS-Gain RPS-Loss
Maelstrom 17.77 17.58
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 57.01 8.70 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Charm + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Charm + Tome Damage Per Second
Count 24999
Mean 1281464.10
Minimum 1033756.32
Maximum 1573480.64
Spread ( max - min ) 539724.32
Range [ ( max - min ) / 2 * 100% ] 21.06%
Standard Deviation 71241.2602
5th Percentile 1167312.15
95th Percentile 1402467.12
( 95th Percentile - 5th Percentile ) 235154.98
Mean Distribution
Standard Deviation 450.5783
95.00% Confidence Intervall ( 1280580.99 - 1282347.22 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11873
0.1 Scale Factor Error with Delta=300 43325827
0.05 Scale Factor Error with Delta=300 173303306
0.01 Scale Factor Error with Delta=300 4332582644
Priority Target DPS
Sample Data Charm + Tome Priority Target Damage Per Second
Count 24999
Mean 1281464.10
Minimum 1033756.32
Maximum 1573480.64
Spread ( max - min ) 539724.32
Range [ ( max - min ) / 2 * 100% ] 21.06%
Standard Deviation 71241.2602
5th Percentile 1167312.15
95th Percentile 1402467.12
( 95th Percentile - 5th Percentile ) 235154.98
Mean Distribution
Standard Deviation 450.5783
95.00% Confidence Intervall ( 1280580.99 - 1282347.22 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 119
0.1% Error 11873
0.1 Scale Factor Error with Delta=300 43325827
0.05 Scale Factor Error with Delta=300 173303306
0.01 Scale Factor Error with Delta=300 4332582644
DPS(e)
Sample Data Charm + Tome Damage Per Second (Effective)
Count 24999
Mean 1281464.10
Minimum 1033756.32
Maximum 1573480.64
Spread ( max - min ) 539724.32
Range [ ( max - min ) / 2 * 100% ] 21.06%
Damage
Sample Data Charm + Tome Damage
Count 24999
Mean 324420404.50
Minimum 262057837.08
Maximum 406929535.45
Spread ( max - min ) 144871698.37
Range [ ( max - min ) / 2 * 100% ] 22.33%
DTPS
Sample Data Charm + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Charm + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Charm + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Charm + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Charm + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Charm + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Charm + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Charm + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.98 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.94 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.30 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 98.58 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.81 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.27 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.67 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 49.03 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLILLLLLILLLLLAILLPNPPQNNLQQNQQQQLNGNIPPLNIIPQLNQJQQLLMNQQQLNQQQQALNQQQLNQQLM97LNQQALNLLPPNOPLNQQQQLLJKIIKKLNGQQQLNLAPPNLLNLLLLLILLMQQLNILPNNPPLNQHQQLJNQQQFLLALILLL9LLILLLLLILLALLMNPOPPLNIQLQLNQQQQLNMPJKKLLNLLLLLIKLLNPLLMNPAQQLNQQLNLQQNQQLAQ9NQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Charm + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.955 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:03.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
0:04.190 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.004 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(4)
0:05.817 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
0:06.619 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
0:07.414 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:07.414 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(7)
0:08.461 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
0:09.495 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
0:10.259 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:11.017 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.026 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.035 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:14.024 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.7/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:15.016 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.7/125: 85% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:15.772 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:16.526 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:17.516 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:18.505 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:19.497 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:20.488 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
0:21.479 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.479 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.336 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.476 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.8/125: 41% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.616 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.756 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.612 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.751 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.890 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.030 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.1/125: 67% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.883 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.878 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.996 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.114 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:35.951 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.7/125: 23% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:37.066 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.184 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.301 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.419 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.536 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:42.648 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:43.759 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:44.871 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
0:45.983 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.462 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.941 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.422 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.534 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.645 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.757 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.238 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.199 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.311 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.792 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.902 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.015 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.126 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.718 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.831 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.942 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.1/125: 22% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.053 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.532 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.010 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.489 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.602 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.082 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.562 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.044 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.496 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.496 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.946 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.9/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.037 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.490 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.943 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.3/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.848 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:30.936 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.388 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:33.840 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.7/125: 49% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:34.951 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:36.063 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:37.176 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:37.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:38.658 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
1:39.768 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:41.247 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.729 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:42.729 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power, rising_tides
1:43.803 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
1:44.865 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
1:45.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
1:47.296 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
1:48.658 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(6)
1:50.031 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.2/125: 65% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(8)
1:51.039 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(9)
1:51.792 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:53.104 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:54.413 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:55.397 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:56.708 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:58.019 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:59.330 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
2:00.640 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
2:01.624 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
2:02.936 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 101.1/125: 81% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.048 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 103.1/125: 82% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.159 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.1/125: 99% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.271 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:07.383 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.494 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:11.085 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:12.196 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:13.308 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 13.1/125: 10% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.789 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.1/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.269 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:17.748 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:19.199 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:20.289 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:21.378 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:21.378 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.832 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.0/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:24.311 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.424 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.904 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.015 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:29.126 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.606 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.087 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.568 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:34.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.8/125: 83% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:36.162 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.8/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:37.272 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.753 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:40.234 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:41.346 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:42.824 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
2:44.304 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.9/125: 68% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:45.394 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.9/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:46.484 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:47.572 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:49.023 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:50.474 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.563 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.653 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.104 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.007 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.7/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.118 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.599 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.711 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.191 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.672 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.1/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.151 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.261 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.372 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.9/125: 22% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.461 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.550 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.640 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 53.9/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:10.640 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.9/125: 43% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.094 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.545 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 89.9/125: 72% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:13.545 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.9/125: 72% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides
3:14.618 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.9/125: 97% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
3:15.700 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
3:17.125 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.9/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)
3:18.531 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(5)
3:19.923 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(7)
3:20.943 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(8)
3:22.284 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.9/125: 82% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(9)
3:23.611 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.9/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:24.595 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:25.909 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:27.220 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:28.533 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:29.845 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.8/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:31.157 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.8/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:32.142 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:33.455 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(10)
3:34.439 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.439 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.920 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.7/125: 77% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.400 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.7/125: 88% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.512 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.7/125: 85% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.624 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.106 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.2/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.862 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.2/125: 44% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.343 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.2/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.823 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.304 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.2/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:47.415 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:48.527 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:50.010 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:51.121 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:52.602 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:54.083 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:55.194 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.2/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:56.674 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:58.125 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.2/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:59.577 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.028 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:02.480 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.2/125: 74% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:03.570 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:04.661 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.8/125: 13% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.111 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:07.347 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.459 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.571 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.8/125: 55% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.682 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.8/125: 73% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.163 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.8/125: 84% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.275 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.754 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.234 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.716 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.0/125: 73% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.195 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.676 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.785 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom ascendance, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:22.898 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:24.378 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:25.829 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.4/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:26.918 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.6/125: 21% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:28.369 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:29.459 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:30.910 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.002 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.6/125: 59% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.092 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.542 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.542 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:35.995 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:37.447 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.927 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:40.038 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.518 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.2/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.000 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.2/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:44.111 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.2/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.222 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.704 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:48.185 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:49.665 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.8/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:50.776 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:52.228 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:53.678 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:55.129 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:55.129 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, rising_tides
4:56.560 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, rising_tides(2)
4:57.643 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.4/125: 70% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, rising_tides(3)
4:58.713 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.5/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63945 61714 51450 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63945 61714 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Charm + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=charm_of_the_rising_tide,id=147002,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=51450
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Sentinel + Terror : 1271085 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1271085.3 1271085.3 831.3 / 0.065% 260499.6 / 20.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sentinel + Terror 1271085
Earth Shock 277070 21.8% 50.4 5.80sec 1648723 1542064 Direct 50.4 1146992 3293514 1648702 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.41 50.41 0.00 0.00 1.0692 0.0000 83120341.09 83120341.09 0.00 1542064.14 1542064.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.63 76.63% 1146991.66 706341 1550899 1146555.18 972952 1312568 44308710 44308710 0.00
crit 11.78 23.37% 3293514.18 2028612 4454181 3291661.86 2320719 4160023 38811631 38811631 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 115610 9.1% 11.3 27.12sec 3060628 2934332 Direct 11.3 85842 251004 207322 73.6%  
Periodic 211.8 47321 188805 152644 74.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.83 211.83 1.0430 1.4075 34683808.70 34683808.70 0.00 111898.78 2934332.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.00 26.44% 85841.88 76807 94440 85372.63 0 94440 257249 257249 0.00
crit 8.34 73.56% 251003.76 220590 271232 251067.09 239895 262284 2092225 2092225 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.1 25.56% 47321.13 184 51943 47329.51 44584 49176 2561795 2561795 0.00
crit 157.7 74.44% 188804.78 253 208853 188824.66 181077 197027 29772539 29772539 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 289792 (441005) 22.8% (34.7%) 95.3 3.10sec 1388416 1053694 Direct 95.1 0 914266 914266 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.29 95.09 0.00 0.00 1.3177 0.0000 86936991.28 86936991.28 0.00 1053694.05 1053694.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.09 100.00% 914265.79 727248 1118612 912745.25 847227 980808 86936991 86936991 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 138244 10.9% 57.1 5.10sec 726887 0 Direct 56.9 0 728794 728794 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.06 56.91 0.00 0.00 0.0000 0.0000 41472967.21 41472967.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.91 100.00% 728793.86 579577 891471 727580.10 653256 794100 41472967 41472967 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 12969 1.0% 70.8 3.90sec 54954 0 Direct 70.8 44201 90175 54954 23.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.80 70.80 0.00 0.00 0.0000 0.0000 3890812.13 3890812.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.24 76.61% 44201.41 42374 47365 44200.51 42494 46124 2397615 2397615 0.00
crit 16.56 23.39% 90175.35 86444 96625 90171.86 86444 96066 1493197 1493197 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 82335 (156072) 6.5% (12.3%) 71.9 4.12sec 651385 477497 Direct 71.9 238654 688170 343640 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.88 71.88 0.00 0.00 1.3642 0.0000 24700001.13 24700001.13 0.00 477496.97 477496.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.09 76.64% 238654.34 152230 561537 239854.73 188862 350238 13147964 13147964 0.00
crit 16.79 23.36% 688169.86 437205 1612735 691171.98 461524 1477032 11552037 11552037 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73737 5.8% 74.5 5.15sec 296840 0 Direct 74.5 206235 593994 296845 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.52 74.52 0.00 0.00 0.0000 0.0000 22120486.48 22120486.48 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.11 76.63% 206234.73 127873 471691 206918.85 150974 303484 11777859 11777859 0.00
crit 17.41 23.37% 593993.52 367252 1354697 595812.09 388943 1090415 10342628 10342628 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (55936) 0.0% (4.4%) 3.0 120.42sec 5593200 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 279660.02 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 18323 1.4% 36.3 7.33sec 151515 0 Direct 36.3 121869 248614 151516 23.4%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.28 36.28 0.00 0.00 0.0000 0.0000 5496621.98 5496621.98 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.79 76.61% 121869.49 121869 121869 121869.49 121869 121869 3387040 3387040 0.00
crit 8.49 23.39% 248613.77 248614 248614 248583.93 0 248614 2109582 2109582 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 37612 3.0% 92.0 2.86sec 122641 0 Direct 92.0 98655 201256 122641 23.4%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.00 92.00 0.00 0.00 0.0000 0.0000 11282979.26 11282979.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.49 76.62% 98654.92 98655 98655 98654.92 98655 98655 6954400 6954400 0.00
crit 21.51 23.38% 201256.04 201256 201256 201256.04 201256 201256 4328579 4328579 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
Terror From Below 49376 3.9% 9.7 29.54sec 1533236 0 Direct 9.7 1233906 2517168 1533178 23.3%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.66 0.00 0.00 0.0000 0.0000 14812813.32 14812813.32 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.41 76.67% 1233905.72 1233906 1233906 1233708.29 0 1233906 9140300 9140300 0.00
crit 2.25 23.33% 2517167.67 2517168 2517168 2283061.71 0 2517168 5672513 5672513 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 233498 / 152907
Fire Blast 201363 10.4% 86.3 3.40sec 458409 221976 Direct 86.3 371722 743389 458403 23.3%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.30 86.30 0.00 0.00 2.0651 0.0000 39561827.82 39561827.82 0.00 221975.63 221975.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.17 76.68% 371722.32 353479 395119 371743.86 363172 384228 24597907 24597907 0.00
crit 20.13 23.32% 743388.67 706958 790238 743450.79 718292 778341 14963921 14963921 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32136 1.7% 10.1 31.03sec 623549 434658 Direct 10.1 109944 219916 135669 23.4%  
Periodic 101.3 39491 79039 48735 23.4% 67.5%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 10.12 101.33 101.33 1.4347 1.9998 6311666.32 6311666.32 0.00 29063.52 434657.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.75 76.61% 109944.49 104735 117072 109952.04 104735 117072 852539 852539 0.00
crit 2.37 23.39% 219915.87 209469 234145 205533.80 0 234145 520725 520725 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.6 76.63% 39490.80 13597 43902 39492.34 38192 41379 3066418 3066418 0.00
crit 23.7 23.37% 79039.35 27193 87804 79035.54 67015 86191 1871984 1871984 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 173301 / 23108
Lightning Blast 173301 1.8% 37.0 7.04sec 187353 179308 Direct 37.0 151829 303722 187361 23.4%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6932049.18 6932049.18 0.00 179308.05 179308.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.35 76.61% 151828.77 145465 162600 151827.29 147239 158859 4303814 4303814 0.00
crit 8.65 23.39% 303721.91 290929 325201 303728.47 290929 325201 2628235 2628235 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Sentinel + Terror
Ascendance 2.0 186.52sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 100.48sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.67sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.74sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.7sec 49.7sec 27.37% 46.52% 0.0(0.0) 5.7

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.20% 32.20% 3.1(3.1) 8.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.5 50.2 4.5sec 2.5sec 68.73% 73.36% 50.2(58.5) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.14%
  • elemental_focus_2:39.59%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.8sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.4 0.7 14.1sec 13.6sec 7.98% 23.39% 0.7(0.7) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.96% 29.96% 4.3(4.3) 12.6

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.9sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 35.0sec 19.7sec 37.79% 34.40% 5.9(16.3) 0.7

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.27%
  • power_of_the_maelstrom_2:6.19%
  • power_of_the_maelstrom_3:25.33%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.8sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.8sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.43% 11.51% 0.0(0.0) 0.2

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.24%
  • stormkeeper_2:3.11%
  • stormkeeper_3:4.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.8sec 100.00% 96.66% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.1 13.6sec
Lava Surge: Wasted 0.7 82.4sec
Lava Surge: During Lava Burst 7.5 35.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6850.0017.5232.3010.00010.026
Fire Elemental0.4310.0011.4810.6370.0004.037
Ascendance6.4860.00269.4936.4180.00069.493
Lava Burst0.8110.0009.8815.4170.00022.996

Resources

Resource Usage Type Count Total Average RPE APR
Sentinel + Terror
earth_shock Maelstrom 50.4 5108.5 101.3 101.3 16271.0
flame_shock Maelstrom 11.3 207.6 18.3 18.3 167033.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.29 1116.88 (20.79%) 11.72 26.59 2.33%
Lava Burst Overload Maelstrom 57.05 487.12 (9.07%) 8.54 26.35 5.13%
Lightning Bolt Maelstrom 71.88 575.03 (10.70%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.52 443.97 (8.26%) 5.96 3.17 0.71%
Aftershock Maelstrom 61.75 1594.85 (29.68%) 25.83 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.47 (5.41%) 0.97 8.11 2.72%
The Deceiver's Blood Pact Maelstrom 10.13 864.49 (16.09%) 85.33 162.01 15.78%
Resource RPS-Gain RPS-Loss
Maelstrom 17.91 17.72
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.98 9.70 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Sentinel + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Sentinel + Terror Damage Per Second
Count 24999
Mean 1271085.27
Minimum 1047156.20
Maximum 1550852.12
Spread ( max - min ) 503695.92
Range [ ( max - min ) / 2 * 100% ] 19.81%
Standard Deviation 67062.7727
5th Percentile 1164114.26
95th Percentile 1384737.29
( 95th Percentile - 5th Percentile ) 220623.03
Mean Distribution
Standard Deviation 424.1507
95.00% Confidence Intervall ( 1270253.95 - 1271916.59 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10694
0.1 Scale Factor Error with Delta=300 38392526
0.05 Scale Factor Error with Delta=300 153570102
0.01 Scale Factor Error with Delta=300 3839252535
Priority Target DPS
Sample Data Sentinel + Terror Priority Target Damage Per Second
Count 24999
Mean 1271085.27
Minimum 1047156.20
Maximum 1550852.12
Spread ( max - min ) 503695.92
Range [ ( max - min ) / 2 * 100% ] 19.81%
Standard Deviation 67062.7727
5th Percentile 1164114.26
95th Percentile 1384737.29
( 95th Percentile - 5th Percentile ) 220623.03
Mean Distribution
Standard Deviation 424.1507
95.00% Confidence Intervall ( 1270253.95 - 1271916.59 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 107
0.1% Error 10694
0.1 Scale Factor Error with Delta=300 38392526
0.05 Scale Factor Error with Delta=300 153570102
0.01 Scale Factor Error with Delta=300 3839252535
DPS(e)
Sample Data Sentinel + Terror Damage Per Second (Effective)
Count 24999
Mean 1271085.27
Minimum 1047156.20
Maximum 1550852.12
Spread ( max - min ) 503695.92
Range [ ( max - min ) / 2 * 100% ] 19.81%
Damage
Sample Data Sentinel + Terror Damage
Count 24999
Mean 328517822.60
Minimum 267245762.42
Maximum 402818341.77
Spread ( max - min ) 135572579.35
Range [ ( max - min ) / 2 * 100% ] 20.63%
DTPS
Sample Data Sentinel + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sentinel + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sentinel + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sentinel + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sentinel + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sentinel + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Sentinel + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sentinel + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.93 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.48 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.08 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.33 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.37 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.58 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.78 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.09 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.24 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 47.62 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLILLLLILLLLILLLNPLNPPQLLIMQQQLNQQQQLNIQQLLNQJQQNLLLKLGLILLLLL97ILLPNPPQLNMQQQLNQLNQLOPPNPQLALJLILQMQNLLILKLLLIPPNQLQNQQMLQLNQQLNQQLQLNLLHLLLJIKKKL9IILLFLLILLLLLIIIIILLLGLLLILOPNLPLNPQQQLALMNQJQLNLIKKLLLILLLLILLLLIILMPPLLN9PQQLNIQQQLN

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Sentinel + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.968 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.085 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.202 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.039 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.878 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.717 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.555 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.673 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:09.791 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:10.630 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.3/125: 87% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.770 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.3/125: 98% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.767 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.886 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:16.003 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.9/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.119 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:17.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.074 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.191 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.332 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.470 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.325 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.467 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.608 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.464 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.318 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.455 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom bloodlust, lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.312 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.168 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.309 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.447 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.588 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.9/125: 59% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.728 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.9/125: 74% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.584 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.9/125: 99% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.440 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.278 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.394 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.511 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.630 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:41.748 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.8/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.858 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.338 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.819 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.301 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.263 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.7/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.374 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.487 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.966 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.446 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.557 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.038 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.150 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.631 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.742 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.852 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.964 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.076 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.558 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.038 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.519 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.8/125: 65% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.629 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.8/125: 82% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.109 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.8/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.222 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.8/125: 90% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.702 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.815 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:17.296 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.776 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.257 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.188 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.278 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:24.278 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:25.368 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:26.823 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.274 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.727 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.816 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.267 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.718 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.170 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:36.651 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:37.762 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.874 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.8/125: 14% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:40.355 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.8/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:41.807 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.8/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:43.259 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.8/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:44.709 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:45.798 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:47.251 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.363 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:49.476 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:52.408 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 52.2/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:53.164 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.2/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.616 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.2/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.066 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:57.156 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.637 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.228 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 89.3/125: 71% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.228 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.3/125: 71% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.339 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 102.3/125: 82% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.451 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.3/125: 83% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.562 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.674 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.156 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.268 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.379 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.491 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.603 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom ascendance, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.084 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom ascendance, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.535 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.1/125: 98% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:15.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.076 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:18.165 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:19.617 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.097 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.7/125: 89% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.578 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.690 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.170 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:26.651 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.761 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.242 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.722 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.203 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.292 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.743 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:36.197 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.286 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.0/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:38.737 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.328 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.437 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.917 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.395 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.875 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.984 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.465 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.8/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.946 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.057 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.017 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.128 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.608 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.088 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.200 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:01.679 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.9/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.159 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.9/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.639 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 109.9/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.751 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.9/125: 96% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.863 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:07.975 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.086 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.198 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.6/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.678 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 108.6/125: 87% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:12.769 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.6/125: 95% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.859 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:14.949 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.040 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:17.491 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:17.491 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:18.943 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.425 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:23.019 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.471 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.922 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:27.012 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.2/125: 87% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:28.464 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.2/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.555 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.644 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.732 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.820 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.908 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.998 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.479 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.960 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.071 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.551 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.030 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.510 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.621 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.102 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.856 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.335 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.445 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.557 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.038 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.520 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.633 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.8/125: 22% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.113 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:57.566 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.8/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:59.018 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:00.468 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.557 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 99.8/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:01.557 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.8/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:03.010 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.8/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.119 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.8/125: 88% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.232 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.713 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.825 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.938 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.419 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:11.510 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom ascendance, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.962 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:14.050 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:15.140 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.679 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.158 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.270 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.471 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.923 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:25.374 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:26.826 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.5/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.413 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.525 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.005 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.9/125: 76% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.486 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.9/125: 94% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.598 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.709 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.822 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:37.933 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:39.412 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:40.894 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:42.004 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:43.482 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.594 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.790 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.8/125: 36% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.270 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.8/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.752 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:50.203 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:51.654 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.8/125: 84% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:52.743 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.832 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:55.284 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.735 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.188 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.667 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Sentinel + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Sentinel + Tome : 1273413 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1273413.4 1273413.4 837.2 / 0.066% 261784.8 / 20.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sentinel + Tome 1273413
Earth Shock 284061 22.3% 50.4 5.78sec 1692324 1582836 Direct 50.4 1206262 3455315 1692330 21.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.35 50.35 0.00 0.00 1.0692 0.0000 85216730.49 85216730.49 0.00 1582836.11 1582836.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.47 78.39% 1206261.57 744671 1626190 1205801.89 1015278 1395715 47613262 47613262 0.00
crit 10.88 21.61% 3455314.52 2138696 4670418 3453743.95 2291460 4513949 37603468 37603468 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 120599 9.5% 11.3 27.13sec 3196089 3064849 Direct 11.3 90324 264042 216745 72.8%  
Periodic 211.8 49799 198898 159212 73.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.83 211.83 1.0429 1.4074 36180537.69 36180537.69 0.00 116732.50 3064848.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.08 27.23% 90323.75 80975 99025 89929.34 0 99025 278417 278417 0.00
crit 8.24 72.77% 264042.17 232560 284399 264100.32 253273 275593 2175116 2175116 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.4 26.62% 49799.45 33 54465 49808.08 46874 51822 2807772 2807772 0.00
crit 155.5 73.38% 198898.22 133 218991 198922.16 191040 206225 30919232 30919232 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 14701 1.2% 5.0 60.53sec 882012 0 Periodic 47.0 77640 158477 93832 20.0% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 47.00 47.00 0.0000 1.2766 4410058.08 4410058.08 0.00 73500.97 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.97% 77640.00 10952 84196 77638.92 72999 84196 2918194 2918194 0.00
crit 9.4 20.03% 158477.49 22343 171760 158452.89 0 171760 1491864 1491864 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:69081.05
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 301704 (459004) 23.7% (36.0%) 95.3 3.14sec 1445441 1097165 Direct 95.1 0 952123 952123 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.26 95.06 0.00 0.00 1.3174 0.0000 90510456.08 90510456.08 0.00 1097165.37 1097165.37
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.06 100.00% 952122.77 766713 1214242 950498.35 877539 1017833 90510456 90510456 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 143838 11.3% 57.0 5.20sec 756813 0 Direct 56.9 0 758828 758828 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.02 56.87 0.00 0.00 0.0000 0.0000 43150782.54 43150782.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.87 100.00% 758827.89 611028 967684 757524.41 691520 818955 43150783 43150783 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13462 1.1% 70.9 3.99sec 56941 0 Direct 70.9 46501 94857 56942 21.6%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.92 70.92 0.00 0.00 0.0000 0.0000 4038501.22 4038501.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.61 78.41% 46501.12 44674 49665 46501.28 44969 48259 2585974 2585974 0.00
crit 15.31 21.59% 94857.47 91134 101316 94856.34 91134 101316 1452527 1452527 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 84242 (159648) 6.6% (12.5%) 72.0 4.05sec 665240 487609 Direct 72.0 252244 706323 351023 21.8%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.99 71.99 0.00 0.00 1.3643 0.0000 25272124.47 25272124.47 0.00 487609.43 487609.43
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.33 78.24% 252243.98 160491 588798 253557.39 201953 352614 14209307 14209307 0.00
crit 15.66 21.76% 706322.85 460930 1691028 709257.02 483843 1345966 11062817 11062817 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 75406 5.9% 74.7 5.02sec 302951 0 Direct 74.7 218003 609346 302942 21.7%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.67 74.67 0.00 0.00 0.0000 0.0000 22621361.52 22621361.52 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.46 78.30% 218002.62 134812 494590 218760.77 159257 325261 12745313 12745313 0.00
crit 16.21 21.70% 609346.49 387181 1420463 611438.08 400845 1161544 9876049 9876049 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (54423) 0.0% (4.3%) 3.0 120.44sec 5441958 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 272097.90 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 17848 1.4% 36.3 7.37sec 147482 0 Direct 36.3 121869 248614 147481 20.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.30 36.30 0.00 0.00 0.0000 0.0000 5354170.15 5354170.15 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.97 79.79% 121869.49 121869 121869 121869.49 121869 121869 3530267 3530267 0.00
crit 7.34 20.21% 248613.77 248614 248614 248573.99 0 248614 1823904 1823904 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 36575 2.9% 92.0 2.86sec 119258 0 Direct 92.0 98655 201256 119257 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.00 92.00 0.00 0.00 0.0000 0.0000 10971703.75 10971703.75 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.53 79.92% 98654.92 98655 98655 98654.92 98655 98655 7253704 7253704 0.00
crit 18.47 20.08% 201256.04 201256 201256 201256.04 201256 201256 3718000 3718000 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 242388 / 157300
Fire Blast 209068 10.7% 85.6 3.40sec 475710 230483 Direct 85.6 390969 781928 475702 21.7%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.57 85.57 0.00 0.00 2.0640 0.0000 40705323.37 40705323.37 0.00 230482.72 230482.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.02 78.32% 390968.66 372661 414301 390990.92 383097 402854 26202914 26202914 0.00
crit 18.55 21.68% 781928.45 745322 828602 781983.90 753329 813044 14502409 14502409 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33320 1.7% 10.0 31.16sec 646053 450437 Direct 10.0 115658 231267 140149 21.2%  
Periodic 100.6 41546 83119 50485 21.5% 67.0%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.04 10.04 100.59 100.59 1.4344 1.9989 6485392.07 6485392.07 0.00 30097.42 450437.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.91 78.82% 115657.97 110418 122756 115669.79 110418 122756 915111 915111 0.00
crit 2.13 21.18% 231266.53 220836 245512 209443.76 0 245512 491722 491722 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.0 78.50% 41546.24 14302 46033 41547.27 40217 43488 3280666 3280666 0.00
crit 21.6 21.50% 83118.70 28605 92067 83120.97 66917 89931 1797893 1797893 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 177565 / 23677
Lightning Blast 177565 1.9% 37.0 7.03sec 191963 183720 Direct 37.0 159717 319531 191961 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7102614.12 7102614.12 0.00 183719.97 183719.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.53 79.82% 159716.85 153358 170494 159717.80 155241 166759 4717120 4717120 0.00
crit 7.47 20.18% 319530.99 306717 340988 319486.24 0 340988 2385494 2385494 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Sentinel + Tome
Ascendance 2.0 186.17sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 101.23sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.90 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sentinel + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.74sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.8sec 49.8sec 27.31% 46.43% 0.0(0.0) 5.7

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.1sec 32.17% 32.17% 3.0(3.0) 8.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.0 49.0 4.5sec 2.6sec 67.75% 72.61% 49.0(56.8) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.94%
  • elemental_focus_2:38.81%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.0 0.0 60.5sec 60.5sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.5 0.7 14.1sec 13.6sec 7.99% 23.45% 0.7(0.7) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.99%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.98% 29.98% 4.3(4.3) 12.6

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.6sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.9sec 19.7sec 37.84% 34.48% 5.9(16.3) 0.7

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.27%
  • power_of_the_maelstrom_2:6.22%
  • power_of_the_maelstrom_3:25.34%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.44% 11.49% 0.0(0.0) 0.2

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.24%
  • stormkeeper_2:3.11%
  • stormkeeper_3:4.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.49% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sentinel + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.2 13.6sec
Lava Surge: Wasted 0.8 84.0sec
Lava Surge: During Lava Burst 7.5 35.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6760.0017.5992.2660.00011.535
Fire Elemental0.4170.0011.4800.5990.0003.879
Ascendance6.3470.00277.5656.2760.00077.565
Lava Burst0.8130.0009.8155.4590.00021.493

Resources

Resource Usage Type Count Total Average RPE APR
Sentinel + Tome
earth_shock Maelstrom 50.4 5100.4 101.3 101.3 16707.8
flame_shock Maelstrom 11.3 207.4 18.3 18.3 174444.9
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.26 1116.56 (20.81%) 11.72 26.61 2.33%
Lava Burst Overload Maelstrom 57.02 486.83 (9.07%) 8.54 26.32 5.13%
Lightning Bolt Maelstrom 72.00 575.97 (10.74%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.67 444.83 (8.29%) 5.96 3.20 0.71%
Aftershock Maelstrom 61.67 1592.34 (29.68%) 25.82 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.48 (5.41%) 0.97 8.11 2.71%
The Deceiver's Blood Pact Maelstrom 10.05 857.81 (15.99%) 85.35 161.15 15.82%
Resource RPS-Gain RPS-Loss
Maelstrom 17.88 17.69
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 58.22 11.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Sentinel + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Sentinel + Tome Damage Per Second
Count 24999
Mean 1273413.45
Minimum 1040927.62
Maximum 1542423.85
Spread ( max - min ) 501496.22
Range [ ( max - min ) / 2 * 100% ] 19.69%
Standard Deviation 67534.7569
5th Percentile 1167010.70
95th Percentile 1388839.17
( 95th Percentile - 5th Percentile ) 221828.47
Mean Distribution
Standard Deviation 427.1358
95.00% Confidence Intervall ( 1272576.27 - 1274250.62 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10805
0.1 Scale Factor Error with Delta=300 38934837
0.05 Scale Factor Error with Delta=300 155739345
0.01 Scale Factor Error with Delta=300 3893483608
Priority Target DPS
Sample Data Sentinel + Tome Priority Target Damage Per Second
Count 24999
Mean 1273413.45
Minimum 1040927.62
Maximum 1542423.85
Spread ( max - min ) 501496.22
Range [ ( max - min ) / 2 * 100% ] 19.69%
Standard Deviation 67534.7569
5th Percentile 1167010.70
95th Percentile 1388839.17
( 95th Percentile - 5th Percentile ) 221828.47
Mean Distribution
Standard Deviation 427.1358
95.00% Confidence Intervall ( 1272576.27 - 1274250.62 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 109
0.1% Error 10805
0.1 Scale Factor Error with Delta=300 38934837
0.05 Scale Factor Error with Delta=300 155739345
0.01 Scale Factor Error with Delta=300 3893483608
DPS(e)
Sample Data Sentinel + Tome Damage Per Second (Effective)
Count 24999
Mean 1273413.45
Minimum 1040927.62
Maximum 1542423.85
Spread ( max - min ) 501496.22
Range [ ( max - min ) / 2 * 100% ] 19.69%
Damage
Sample Data Sentinel + Tome Damage
Count 24999
Mean 327726425.98
Minimum 265773799.91
Maximum 408727801.90
Spread ( max - min ) 142954001.99
Range [ ( max - min ) / 2 * 100% ] 21.81%
DTPS
Sample Data Sentinel + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sentinel + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sentinel + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sentinel + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sentinel + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sentinel + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Sentinel + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Sentinel + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.90 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 8.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.49 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.25 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.38 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.56 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.76 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.10 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.32 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 47.64 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLILLLLLILLALLLIILLLLILLLMNIPPPNQLQLNQLLNPPPLNJQQQNLQMQQQLNQQQANLI97QQLLLIQQQLMNQQQLNPOPPLNQQQAJLKKIKLLMNQQQLNNQAQQLNQQQLNMQQQLNQQQNLPPPNQLHQLNJLKKKLILL9FLLLILALLLLLILLMPPNPLONQQQLNQQQLNQMQAQLJNQQQNLPPPNILLQANNIQLMQQNQLPNPPLLNIQQQLNQQQL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Sentinel + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.082 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.200 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.039 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.878 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.718 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.558 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.558 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:08.675 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:09.794 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.3/125: 85% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.072 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.927 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.920 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.059 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.199 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.341 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.197 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.314 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.433 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.433 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.271 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.389 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.508 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.348 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.204 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.057 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.197 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.336 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.474 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.330 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.469 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.609 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:34.746 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.6/125: 82% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:35.602 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.6/125: 79% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:36.457 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:37.313 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:38.431 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:39.550 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:40.668 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:41.508 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:42.958 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.2/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:44.438 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.2/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:45.919 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.2/125: 60% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.029 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.142 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.622 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.101 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.212 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.324 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.806 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.2/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.286 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.764 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:59.245 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.2/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.356 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.467 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.579 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.692 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.802 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.914 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.396 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.875 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.1/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.986 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.467 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.947 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.1/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.427 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.907 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.1/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.018 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.499 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.979 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.459 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.459 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:22.547 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.1/125: 85% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.997 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.1/125: 95% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.087 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.177 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.177 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:27.627 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.8/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.697 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.8/125: 77% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.809 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.919 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:35.399 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:36.880 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:38.360 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:39.841 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:40.953 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:42.064 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:43.545 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:45.026 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:46.506 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.986 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.099 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.578 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.335 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.816 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.296 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.8/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.778 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.8/125: 83% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.890 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.371 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:59.824 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.275 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:01.275 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:02.553 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.643 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.732 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.844 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.956 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.067 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.180 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.662 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.774 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:12.863 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.315 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:15.768 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.219 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:18.669 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.1/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:19.758 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.1/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:20.848 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.331 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.331 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:23.784 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:25.235 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:26.686 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.6/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:27.776 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.228 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.707 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.188 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.669 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.780 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.2/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:35.892 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.2/125: 14% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:37.374 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.2/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:38.853 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.2/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:40.334 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:41.815 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.2/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:42.928 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:44.409 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:45.889 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:47.370 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.481 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.8/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.959 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.410 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.861 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.314 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.8/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.402 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:56.855 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:58.336 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:59.448 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:00.930 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.4/125: 52% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:02.040 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.4/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:03.151 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 29.0/125: 23% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:04.240 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:05.690 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom ascendance, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.780 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom ascendance, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.869 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.960 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/125: 88% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.442 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.552 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.6/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.032 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.6/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.512 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.624 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.624 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.6/125: 61% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.106 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.6/125: 72% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:18.585 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.6/125: 90% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.065 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.176 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.657 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.657 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.767 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.246 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.699 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.150 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.602 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.803 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.283 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.395 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.876 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:37.358 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:38.469 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.1/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:39.949 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:41.430 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 67.1/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:42.183 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:43.296 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:44.777 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:46.258 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:47.739 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.220 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.9/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.332 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.8/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.814 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.295 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.8/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.773 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.251 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.8/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.361 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.842 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.953 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.434 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.434 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.915 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.395 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.506 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.619 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.731 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.844 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.956 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.068 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.1/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.519 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.971 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:15.422 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.1/125: 55% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.874 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.1/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.986 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.097 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.576 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.688 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.171 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.171 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.283 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.395 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.508 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.989 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.471 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.582 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.063 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.544 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.656 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.137 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:37.616 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:39.095 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:40.204 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:41.686 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.1/125: 36% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:43.167 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:44.278 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:45.758 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.1/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:46.870 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:47.979 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.458 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.938 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.419 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.900 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.011 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.491 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.1/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.942 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.1/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:59.393 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.1/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Sentinel + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=tarnished_sentinel_medallion,id=147017,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Terror + Tome : 1278996 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1278996.1 1278996.1 869.2 / 0.068% 272598.0 / 21.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Terror + Tome 1278996
Earth Shock 289556 22.6% 49.2 5.89sec 1767003 1652352 Direct 49.2 1199797 3462745 1766921 25.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.16 49.16 0.00 0.00 1.0694 0.0000 86865785.32 86865785.32 0.00 1652351.78 1652351.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.84 74.94% 1199797.17 744671 1626190 1199294.37 1001965 1409537 44198146 44198146 0.00
crit 12.32 25.06% 3462744.56 2138696 4670418 3460944.30 2495391 4435714 42667639 42667639 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 122518 9.6% 11.3 27.14sec 3243592 3110700 Direct 11.3 90415 263981 218540 73.8%  
Periodic 211.8 49843 198257 161827 75.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.83 211.83 1.0428 1.4075 36756036.56 36756036.56 0.00 118583.93 3110700.45
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.97 26.17% 90414.97 80975 99025 89980.81 0 99025 268183 268183 0.00
crit 8.37 73.83% 263981.49 232560 284399 264045.24 250684 275593 2208416 2208416 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.0 24.55% 49843.01 232 54465 49851.32 46352 51906 2591529 2591529 0.00
crit 159.8 75.45% 198257.34 545 218991 198279.55 189585 206378 31687909 31687909 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 15147 1.2% 5.1 60.41sec 885159 0 Periodic 47.0 77677 158588 96629 23.4% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 47.02 47.02 0.0000 1.2767 4543844.95 4543844.95 0.00 75686.60 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.0 76.58% 77677.41 10952 84196 77677.46 72622 84196 2797238 2797238 0.00
crit 11.0 23.42% 158588.39 22343 171760 158571.21 85731 171760 1746607 1746607 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:69081.05
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 308580 (451373) 24.1% (35.3%) 95.2 3.11sec 1421663 1079142 Direct 95.0 0 973948 973948 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.25 95.05 0.00 0.00 1.3174 0.0000 92571136.44 92571136.44 0.00 1079141.87 1079141.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.05 100.00% 973948.08 766713 1245184 972401.68 896563 1047942 92571136 92571136 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 128910 10.1% 50.0 5.87sec 774159 0 Direct 49.8 0 776196 776196 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.95 49.82 0.00 0.00 0.0000 0.0000 38671603.82 38671603.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.82 100.00% 776195.86 611028 992342 774969.13 696549 848162 38671604 38671604 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13883 1.1% 70.9 3.92sec 58764 0 Direct 70.9 46497 94858 58765 25.4%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.87 70.87 0.00 0.00 0.0000 0.0000 4164744.70 4164744.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.89 74.63% 46496.81 44674 49665 46496.15 45095 48363 2459438 2459438 0.00
crit 17.98 25.37% 94858.41 91134 101316 94856.02 91134 99861 1705307 1705307 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 88415 (161936) 6.9% (12.7%) 72.9 4.06sec 666806 488541 Direct 72.9 251136 713517 364064 24.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.86 72.86 0.00 0.00 1.3649 0.0000 26524354.29 26524354.29 0.00 488541.29 488541.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.06 75.58% 251136.18 160491 588798 252376.50 201802 365630 13827896 13827896 0.00
crit 17.79 24.42% 713516.50 460930 1691028 716658.69 487235 1263410 12696458 12696458 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73522 5.7% 70.0 5.39sec 315235 0 Direct 70.0 217390 618000 315230 24.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.97 69.97 0.00 0.00 0.0000 0.0000 22056191.17 22056191.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.88 75.58% 217390.18 134812 494590 218057.75 149510 330829 11495473 11495473 0.00
crit 17.09 24.42% 617999.95 387181 1420463 619615.33 404389 1291004 10560718 10560718 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 50073 3.9% 9.7 29.85sec 1554619 0 Direct 9.7 1233906 2517168 1554716 25.0%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.66 0.00 0.00 0.0000 0.0000 15022013.13 15022013.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.25 75.01% 1233905.72 1233906 1233906 1233905.72 1233906 1233906 8943213 8943213 0.00
crit 2.41 24.99% 2517167.67 2517168 2517168 2323237.31 0 2517168 6078800 6078800 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 248341 / 164045
Fire Blast 214170 11.1% 87.0 3.39sec 487764 236065 Direct 87.0 390778 781753 487774 24.8%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.02 87.02 0.00 0.00 2.0662 0.0000 42444802.75 42444802.75 0.00 236065.44 236065.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.43 75.19% 390777.56 372661 414301 390803.29 382270 400983 25569864 25569864 0.00
crit 21.59 24.81% 781753.40 745322 828602 781787.08 758134 813766 16874939 16874939 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34171 1.8% 10.2 30.88sec 663770 462606 Direct 10.2 115592 231361 144788 25.2%  
Periodic 102.1 41547 83008 51865 24.9% 68.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.20 10.20 102.05 102.05 1.4349 2.0006 6769769.33 6769769.33 0.00 30939.74 462605.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.63 74.78% 115591.94 110418 122756 115593.31 110418 121490 881619 881619 0.00
crit 2.57 25.22% 231361.19 220836 245512 219185.10 0 245512 595045 595045 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.7 75.11% 41547.46 14302 46033 41549.24 40094 43473 3184903 3184903 0.00
crit 25.4 24.89% 83008.01 28605 92067 83012.30 73259 89519 2108202 2108202 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182597 / 24348
Lightning Blast 182597 1.9% 37.0 7.04sec 197402 188930 Direct 37.0 159744 319510 197397 23.6%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0448 0.0000 7303863.76 7303863.76 0.00 188930.49 188930.49
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.28 76.43% 159743.60 153358 170494 159741.46 155093 166884 4517329 4517329 0.00
crit 8.72 23.57% 319510.46 306717 340988 319505.81 0 340988 2786534 2786534 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Terror + Tome
Ascendance 2.0 186.24sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 100.20sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Terror + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.68sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.70sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.0sec 50.0sec 26.96% 46.28% 0.0(0.0) 5.7

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.1sec 32.20% 32.20% 3.0(3.0) 8.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.4 51.5 4.5sec 2.5sec 69.40% 73.76% 51.5(60.2) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.14%
  • elemental_focus_2:40.26%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 7.97% 23.46% 0.7(0.7) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.97%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.96% 29.96% 4.3(4.3) 12.6

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.4sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.8sec 19.7sec 37.54% 34.20% 5.9(16.1) 0.7

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.26%
  • power_of_the_maelstrom_2:6.24%
  • power_of_the_maelstrom_3:25.04%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.38% 11.33% 0.0(0.0) 0.2

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.22%
  • stormkeeper_2:3.08%
  • stormkeeper_3:4.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.64% 2.0(2.0) 0.0

Buff details

  • buff initial source:Terror + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.7 82.9sec
Lava Surge: During Lava Burst 7.5 35.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6770.0017.3492.2660.0009.161
Fire Elemental0.4400.0011.4800.6630.0003.868
Ascendance6.3280.00167.4826.2540.00067.482
Lava Burst0.8220.00010.0025.5300.00025.436

Resources

Resource Usage Type Count Total Average RPE APR
Terror + Tome
earth_shock Maelstrom 49.2 4958.5 100.9 100.9 17518.7
flame_shock Maelstrom 11.3 207.6 18.3 18.3 177021.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.24 1118.06 (21.41%) 11.74 24.87 2.18%
Lava Burst Overload Maelstrom 49.95 427.35 (8.18%) 8.56 22.22 4.94%
Lightning Bolt Maelstrom 72.86 582.86 (11.16%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 69.97 416.93 (7.98%) 5.96 2.89 0.69%
Aftershock Maelstrom 60.49 1549.83 (29.68%) 25.62 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.96 (5.57%) 0.97 7.63 2.55%
The Deceiver's Blood Pact Maelstrom 9.81 836.33 (16.01%) 85.23 153.69 15.52%
Resource RPS-Gain RPS-Loss
Maelstrom 17.41 17.22
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.18 11.00 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Terror + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Terror + Tome Damage Per Second
Count 24999
Mean 1278996.06
Minimum 1025497.34
Maximum 1588457.78
Spread ( max - min ) 562960.44
Range [ ( max - min ) / 2 * 100% ] 22.01%
Standard Deviation 70118.5910
5th Percentile 1168111.88
95th Percentile 1396556.33
( 95th Percentile - 5th Percentile ) 228444.45
Mean Distribution
Standard Deviation 443.4778
95.00% Confidence Intervall ( 1278126.86 - 1279865.26 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 116
0.1% Error 11546
0.1 Scale Factor Error with Delta=300 41971069
0.05 Scale Factor Error with Delta=300 167884276
0.01 Scale Factor Error with Delta=300 4197106891
Priority Target DPS
Sample Data Terror + Tome Priority Target Damage Per Second
Count 24999
Mean 1278996.06
Minimum 1025497.34
Maximum 1588457.78
Spread ( max - min ) 562960.44
Range [ ( max - min ) / 2 * 100% ] 22.01%
Standard Deviation 70118.5910
5th Percentile 1168111.88
95th Percentile 1396556.33
( 95th Percentile - 5th Percentile ) 228444.45
Mean Distribution
Standard Deviation 443.4778
95.00% Confidence Intervall ( 1278126.86 - 1279865.26 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 116
0.1% Error 11546
0.1 Scale Factor Error with Delta=300 41971069
0.05 Scale Factor Error with Delta=300 167884276
0.01 Scale Factor Error with Delta=300 4197106891
DPS(e)
Sample Data Terror + Tome Damage Per Second (Effective)
Count 24999
Mean 1278996.06
Minimum 1025497.34
Maximum 1588457.78
Spread ( max - min ) 562960.44
Range [ ( max - min ) / 2 * 100% ] 22.01%
Damage
Sample Data Terror + Tome Damage
Count 24999
Mean 327175710.38
Minimum 254855167.97
Maximum 420883758.54
Spread ( max - min ) 166028590.56
Range [ ( max - min ) / 2 * 100% ] 25.37%
DTPS
Sample Data Terror + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Terror + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Terror + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Terror + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Terror + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Terror + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Terror + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Terror + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.13 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.44 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.08 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.31 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.36 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.54 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.81 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 29.85 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.44 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 48.41 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHKKKFLLILLLLLLILLLLLLILLLLLIILLMPNPPQNLQQQLNLLQNLPPJAKLIIMQLQQNQQLQN97QQLLNLQQNLMLLLLLILLLNPOPPLNQQLQAJLLMNNQQLNQQQQLNQQQNLLLLLLILLMNLLLLLIILL9NNHLLALJKKIKLLFLLILLLLILLLLLLIIILGLLPNOPPLNQQQLLNILLLALIJKGKKLLLILLNPPP9LNLLLLLIGLLPNPPQLNQQQQLNLL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Terror + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.085 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.203 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.041 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.879 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.3/125: 42% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.717 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.556 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.556 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.548 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.3/125: 99% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.404 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.543 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.683 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.822 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:14.962 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.2/125: 79% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:16.101 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.2/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:17.242 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:18.098 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:19.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:20.377 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:21.518 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:22.657 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:23.775 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:24.892 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:25.730 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.083 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.222 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.076 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.931 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.785 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.902 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.020 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:35.858 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:36.974 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.814 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:38.931 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.9/125: 32% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:40.049 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.9/125: 50% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:41.189 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.300 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:43.781 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:45.233 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.686 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:48.138 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.227 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.7/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.338 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.2/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.818 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.2/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.298 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.779 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.2/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.889 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.000 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.451 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.903 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.090 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 89.8/125: 72% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.090 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 89.8/125: 72% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.179 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.8/125: 84% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.659 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.8/125: 94% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.770 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.881 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.994 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.105 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.585 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.697 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.177 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.290 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
1:14.770 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:16.251 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.2/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:17.732 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.2/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:19.184 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:20.273 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:21.363 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:21.363 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:22.815 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:24.267 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
1:25.379 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:26.859 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.971 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.082 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.562 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.041 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.132 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:34.584 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:35.674 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:37.125 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:38.576 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.055 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.0/125: 71% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.536 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.0/125: 82% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.647 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:43.759 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.240 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:46.720 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.832 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.945 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.6/125: 22% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.426 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.178 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.659 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.139 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.621 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.6/125: 76% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.735 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.8/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.215 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.693 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.803 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.283 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.283 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.394 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.505 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.986 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.8/125: 79% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.096 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.8/125: 69% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.208 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.319 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.9/125: 28% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.432 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.543 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.024 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:14.135 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:15.246 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
2:16.727 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
2:18.209 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
2:19.689 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:21.140 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:22.230 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
2:23.680 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:25.131 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
2:26.582 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:27.673 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:28.762 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:30.214 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.694 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.173 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.4/125: 81% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.654 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.4/125: 92% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:36.134 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.247 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.728 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.209 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.321 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.434 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.914 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.5/125: 29% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.394 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.5/125: 47% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.872 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.353 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.833 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.942 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.055 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.534 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.985 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.074 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.162 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.251 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.339 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.7/125: 14% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.792 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.271 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.271 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.752 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.864 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.973 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.7/125: 79% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.085 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.7/125: 96% maelstrom ascendance, lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.198 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.309 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.420 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.899 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.899 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.380 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.4/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.859 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:15.970 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:17.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:18.562 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:20.041 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:21.521 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:22.632 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:24.112 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:25.592 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:27.072 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.553 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:30.005 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.457 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:32.546 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.636 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.726 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.207 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.320 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.432 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.912 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.392 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.504 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.259 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.740 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.4/125: 40% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.190 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:47.641 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.731 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.185 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.664 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.145 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.256 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.2/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.738 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.2/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.848 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.958 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.439 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.919 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.397 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.397 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.877 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.988 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.097 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.2/125: 31% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.208 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.319 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.2/125: 32% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.431 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.2/125: 49% maelstrom ascendance, lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.542 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.2/125: 67% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.655 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.2/125: 77% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:13.135 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:14.616 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.2/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:15.728 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:17.209 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:18.660 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:19.751 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:21.201 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:22.654 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
4:24.106 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:25.216 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.3/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:26.696 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.3/125: 89% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:27.807 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.288 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.768 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.251 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.6/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.731 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.6/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.212 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.324 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.434 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.914 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.3/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:40.366 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.818 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.906 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.359 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.841 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:47.321 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.801 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.912 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.392 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.873 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:54.354 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.3/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.317 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.429 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.7/125: 22% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.911 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Terror + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=terror_from_below,id=147016,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Sentinel : 1248195 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1248195.3 1248195.3 799.3 / 0.064% 247591.3 / 19.8% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Sentinel 1248195
Earth Shock 271785 21.8% 50.4 5.78sec 1617981 1513349 Direct 50.4 1175710 3375573 1618077 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.39 50.39 0.00 0.00 1.0692 0.0000 81534687.86 81534687.86 0.00 1513348.70 1513348.70
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.26 79.89% 1175709.88 724942 1591741 1175274.93 977286 1344923 47334960 47334960 0.00
crit 10.13 20.11% 3375572.78 2082035 4571481 3374107.87 2333366 4571481 34199728 34199728 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 116905 9.4% 11.3 27.11sec 3097434 2969952 Direct 11.3 88046 257698 209920 71.8%  
Periodic 211.8 48539 194416 154345 72.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.83 211.83 1.0430 1.4074 35072158.17 35072158.17 0.00 113156.80 2969951.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.19 28.16% 88046.21 78830 96927 87891.56 0 96927 280762 280762 0.00
crit 8.13 71.84% 257698.33 226399 278375 257762.51 246566 269541 2096163 2096163 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.2 27.47% 48539.45 2262 53311 48547.31 45595 50608 2824494 2824494 0.00
crit 153.6 72.53% 194416.10 130 214353 194444.95 186404 201705 29870739 29870739 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 292845 (445574) 23.5% (35.7%) 95.3 3.12sec 1402402 1064499 Direct 95.1 0 923605 923605 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.32 95.12 0.00 0.00 1.3174 0.0000 87852331.75 87852331.75 0.00 1064498.86 1064498.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.12 100.00% 923605.19 746400 1117784 922242.82 858353 987627 87852332 87852332 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 139756 11.2% 57.1 5.15sec 734192 0 Direct 57.0 0 736096 736096 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 57.10 56.96 0.00 0.00 0.0000 0.0000 41925817.30 41925817.30 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 56.96 100.00% 736096.38 594839 890812 735016.03 674609 793392 41925817 41925817 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 12974 1.0% 71.0 3.95sec 54828 0 Direct 71.0 45368 92547 54827 20.1%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.99 70.99 0.00 0.00 0.0000 0.0000 3892036.77 3892036.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.75 79.95% 45368.30 43490 48613 45368.71 43682 47346 2574772 2574772 0.00
crit 14.23 20.05% 92547.07 88720 99170 92544.30 88720 99170 1317264 1317264 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 80687 (152906) 6.5% (12.3%) 71.9 4.07sec 637699 467387 Direct 71.9 244489 704319 336510 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 71.93 71.93 0.00 0.00 1.3644 0.0000 24205633.71 24205633.71 0.00 467386.83 467386.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.54 79.99% 244488.59 156239 576325 245692.05 196933 363410 14067184 14067184 0.00
crit 14.39 20.01% 704319.41 448719 1655206 707535.73 465019 1443887 10138450 10138450 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 72219 5.8% 74.6 5.09sec 290566 0 Direct 74.6 211225 606880 290572 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.56 74.56 0.00 0.00 0.0000 0.0000 21665111.85 21665111.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.61 79.95% 211225.01 131241 484113 211920.86 158295 317400 12591104 12591104 0.00
crit 14.95 20.05% 606879.74 376924 1390373 609014.07 391832 1261255 9074007 9074007 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31457 2.5% 16.2 18.30sec 583413 0 Direct 16.0 487076 993635 589007 20.1%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.18 16.02 0.00 0.00 0.0000 0.0000 9437264.10 9437264.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.80 79.88% 487076.02 487076 487076 487076.02 487076 487076 6233497 6233497 0.00
crit 3.22 20.12% 993635.07 993635 993635 959969.37 0 993635 3203767 3203767 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
Spectral Owl 0 (55871) 0.0% (4.5%) 3.0 120.41sec 5586785 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 279339.26 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 18323 1.5% 36.3 7.36sec 151321 0 Direct 36.3 125079 255161 151321 20.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.32 36.32 0.00 0.00 0.0000 0.0000 5496674.37 5496674.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.00 79.83% 125078.89 125079 125079 125078.89 125079 125079 3626893 3626893 0.00
crit 7.33 20.17% 255160.93 255161 255161 255028.25 0 255161 1869782 1869782 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 37548 3.0% 92.0 2.86sec 122431 0 Direct 92.0 101253 206556 122433 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.00 92.00 0.00 0.00 0.0000 0.0000 11263681.44 11263681.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.50 79.89% 101252.97 101253 101253 101252.97 101253 101253 7441804 7441804 0.00
crit 18.50 20.11% 206556.06 206556 206556 206556.06 206556 206556 3821878 3821878 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 233667 / 150602
Fire Blast 201468 10.4% 85.0 3.41sec 458190 222087 Direct 85.0 381656 763326 458193 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.02 85.02 0.00 0.00 2.0631 0.0000 38956919.25 38956919.25 0.00 222086.84 222086.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.97 79.95% 381656.30 362788 405524 381681.67 373167 393345 25942870 25942870 0.00
crit 17.05 20.05% 763326.08 725575 811049 763390.17 734968 796490 13014049 13014049 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32199 1.7% 10.0 31.30sec 623904 435046 Direct 10.0 112886 225841 135736 20.2%  
Periodic 100.0 40547 81094 48681 20.1% 66.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.98 9.98 100.05 100.05 1.4342 1.9982 6224638.31 6224638.31 0.00 29057.49 435046.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.96 79.77% 112885.88 107493 120155 112893.06 108304 119344 898388 898388 0.00
crit 2.02 20.23% 225840.82 214985 240311 202347.68 0 240311 455873 455873 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.0 79.94% 40546.78 13955 45058 40547.88 39162 42299 3242770 3242770 0.00
crit 20.1 20.06% 81093.67 27909 90117 81100.13 66914 87884 1627608 1627608 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 173197 / 23094
Lightning Blast 173197 1.9% 37.0 7.03sec 187240 179191 Direct 37.0 155830 311717 187242 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6927886.75 6927886.75 0.00 179191.11 179191.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.54 79.85% 155830.28 149295 166882 155831.75 151228 163140 4603965 4603965 0.00
crit 7.46 20.15% 311716.90 298591 333765 311659.57 0 333765 2323922 2323922 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Sentinel
Ascendance 2.0 186.16sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 102.31sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.87 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.83sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.7sec 49.7sec 27.38% 46.52% 0.0(0.0) 5.7

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.1sec 25.0sec 32.25% 32.25% 3.0(3.0) 8.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.4 47.8 4.5sec 2.6sec 66.81% 71.74% 47.8(55.2) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.82%
  • elemental_focus_2:37.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 8.00% 23.45% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.00%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.95% 29.95% 4.2(4.2) 12.6

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.6sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 35.0sec 19.7sec 37.74% 34.40% 5.9(16.2) 0.7

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.24%
  • power_of_the_maelstrom_2:6.25%
  • power_of_the_maelstrom_3:25.25%

Trigger Attempt Success

  • trigger_pct:14.96%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.10% 16.10% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.47% 11.49% 0.0(0.0) 0.2

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.25%
  • stormkeeper_2:3.12%
  • stormkeeper_3:4.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.57% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.8 83.7sec
Lava Surge: During Lava Burst 7.5 35.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6820.0017.6652.2860.00010.794
Fire Elemental0.4010.0011.4810.5620.0003.812
Ascendance6.3690.00174.6826.2930.00074.682
Lava Burst0.8110.00011.6635.4310.00022.926

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Sentinel
earth_shock Maelstrom 50.4 5105.2 101.3 101.3 15970.9
flame_shock Maelstrom 11.3 207.5 18.3 18.3 169054.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.31 1117.23 (20.81%) 11.72 26.55 2.32%
Lava Burst Overload Maelstrom 57.11 487.54 (9.08%) 8.54 26.42 5.14%
Lightning Bolt Maelstrom 71.93 575.45 (10.72%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 74.56 444.24 (8.27%) 5.96 3.15 0.70%
Aftershock Maelstrom 61.72 1593.80 (29.68%) 25.82 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.48 (5.41%) 0.97 8.10 2.71%
The Deceiver's Blood Pact Maelstrom 10.09 860.92 (16.03%) 85.33 161.20 15.77%
Resource RPS-Gain RPS-Loss
Maelstrom 17.90 17.71
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 57.32 11.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Thurible + Sentinel Damage Per Second
Count 24999
Mean 1248195.27
Minimum 1026716.10
Maximum 1562066.70
Spread ( max - min ) 535350.60
Range [ ( max - min ) / 2 * 100% ] 21.44%
Standard Deviation 64483.1472
5th Percentile 1146249.13
95th Percentile 1358215.76
( 95th Percentile - 5th Percentile ) 211966.63
Mean Distribution
Standard Deviation 407.8354
95.00% Confidence Intervall ( 1247395.93 - 1248994.61 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10253
0.1 Scale Factor Error with Delta=300 35495731
0.05 Scale Factor Error with Delta=300 141982923
0.01 Scale Factor Error with Delta=300 3549573064
Priority Target DPS
Sample Data Thurible + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1248195.27
Minimum 1026716.10
Maximum 1562066.70
Spread ( max - min ) 535350.60
Range [ ( max - min ) / 2 * 100% ] 21.44%
Standard Deviation 64483.1472
5th Percentile 1146249.13
95th Percentile 1358215.76
( 95th Percentile - 5th Percentile ) 211966.63
Mean Distribution
Standard Deviation 407.8354
95.00% Confidence Intervall ( 1247395.93 - 1248994.61 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 103
0.1% Error 10253
0.1 Scale Factor Error with Delta=300 35495731
0.05 Scale Factor Error with Delta=300 141982923
0.01 Scale Factor Error with Delta=300 3549573064
DPS(e)
Sample Data Thurible + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1248195.27
Minimum 1026716.10
Maximum 1562066.70
Spread ( max - min ) 535350.60
Range [ ( max - min ) / 2 * 100% ] 21.44%
Damage
Sample Data Thurible + Sentinel Damage
Count 24999
Mean 322345397.31
Minimum 261440698.90
Maximum 402620751.36
Spread ( max - min ) 141180052.46
Range [ ( max - min ) / 2 * 100% ] 21.90%
DTPS
Sample Data Thurible + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.42 totem_mastery,if=buff.resonance_totem.remains<2
9 3.87 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.50 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.29 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.61 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.75 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 30.10 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.58 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.29 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 47.64 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQQFLLLILLLLLILLLLLILLLLLLILLLMNPPPNQLPPNPLLLNQQLJKKIKLLMNQQLLL97IQQLNQQQQLLNMQQQLNNQQQLNOQQQLLIQAJQLKKILPMLNQQQLLNIQQQLLNLLLLLILGLPNPLLNPLNP9HLPJNLKKKFLLILLLLLILLLNLQMQQLNQLQQLLIIIL8LLLLILLLLAILJKGKKLILQQNLLLLLIL9LMQNNQLLQNQQLNQQQQLNQQQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.968 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:03.108 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:04.247 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.3/125: 22% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.100 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.957 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.810 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.667 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.521 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.521 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.662 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:10.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:11.938 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:12.795 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:15.072 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:16.212 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:17.350 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:18.490 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:19.346 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:20.485 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:21.626 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.1/125: 66% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:22.765 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:23.904 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:25.044 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.900 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.041 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.182 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.320 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.175 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.317 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.434 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.273 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.112 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.230 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:36.348 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.187 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.042 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.183 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.323 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:41.461 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:42.573 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:44.053 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:45.534 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:47.017 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.498 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.609 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:52.200 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.0/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:53.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:55.131 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:56.221 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.673 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:59.124 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.574 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/125: 60% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.685 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/125: 68% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.797 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.909 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.022 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.134 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.246 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.726 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.839 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.950 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.1/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.430 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.910 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.023 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.504 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.1/125: 70% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.615 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 118.1/125: 94% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.727 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 119.1/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.727 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.1/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:19.838 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:21.319 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.801 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.280 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.391 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:26.874 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.354 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.834 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:31.314 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.425 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.3/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.906 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:35.018 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:36.131 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.8/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:37.613 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.093 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.8/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:40.545 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:41.997 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:43.086 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.6/125: 81% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:44.175 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:45.626 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:47.108 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:48.589 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:50.069 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.9/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.179 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.932 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.412 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.893 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:56.374 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.855 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.4/125: 72% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.965 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.4/125: 97% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.078 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.558 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.558 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:02.791 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:03.903 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:05.014 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:06.127 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.7/125: 78% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.238 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.7/125: 96% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.349 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.830 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.4/125: 40% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:11.312 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:12.401 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:13.851 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.941 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.392 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.845 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.323 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:20.436 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.7/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:21.917 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.7/125: 79% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:23.026 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:24.138 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:25.619 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.100 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.580 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.693 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:31.174 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:32.284 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.763 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.245 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.725 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.9/125: 74% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.208 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.9/125: 86% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:39.689 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.9/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.801 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.281 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:43.394 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.876 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:46.358 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.6/125: 64% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:47.470 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.953 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.065 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.545 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.655 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.136 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.7/125: 37% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.249 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.361 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.811 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.900 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.991 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.442 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.892 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.005 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.116 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.4/125: 20% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.598 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.708 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.817 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.928 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.928 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.408 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.4/125: 93% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.890 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.979 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.431 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.883 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:17.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:19.424 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:20.906 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.016 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.496 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:24.978 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:26.458 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.571 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.9/125: 22% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.685 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.166 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:31.278 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.758 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.9/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.9/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.717 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.9/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.829 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.309 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.420 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.900 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.381 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.860 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.7/125: 83% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.970 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.083 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:47.173 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:48.262 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:49.351 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:50.107 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:51.557 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:52.647 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.129 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.608 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.200 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:59.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:01.131 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.582 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 119.7/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:02.582 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.7/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:03.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:05.121 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 50.4/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:06.210 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:07.301 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.4/125: 58% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:08.391 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.501 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.613 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.725 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.4/125: 95% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.835 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.316 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.796 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.249 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:18.339 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.0/125: 19% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.791 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:21.243 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:22.695 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.0/125: 59% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:24.147 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:25.627 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.0/125: 95% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:26.738 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:28.218 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.329 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:30.811 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.922 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.402 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.514 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.7/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.625 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.104 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:38.216 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:39.697 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.1/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:41.178 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.1/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.266 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.718 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:45.170 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.6/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:46.620 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.731 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.211 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.691 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.7/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.171 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:53.653 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:55.133 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.7/125: 82% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.245 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.726 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:59.177 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Terror : 1249319 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1249319.1 1249319.1 838.3 / 0.067% 263138.6 / 21.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Terror 1249319
Earth Shock 276050 22.1% 49.2 5.89sec 1683347 1574051 Direct 49.2 1172013 3362396 1683343 23.3%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.20 49.20 0.00 0.00 1.0694 0.0000 82813946.27 82813946.27 0.00 1574050.53 1574050.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.71 76.66% 1172012.73 724942 1591741 1171483.44 975590 1395228 44197759 44197759 0.00
crit 11.48 23.34% 3362396.38 2082035 4571481 3360239.34 2405753 4376920 38616187 38616187 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 118634 9.5% 11.3 27.11sec 3141511 3012355 Direct 11.3 88106 257595 212628 73.5%  
Periodic 211.8 48573 193784 156652 74.4% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.82 211.82 1.0429 1.4075 35590977.21 35590977.21 0.00 114825.16 3012355.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.01 26.53% 88105.67 78830 96927 87653.21 0 96927 264862 264862 0.00
crit 8.32 73.47% 257594.54 226399 278375 257659.60 247102 269541 2143979 2143979 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.2 25.57% 48572.93 1099 53311 48580.00 45683 50528 2631059 2631059 0.00
crit 157.7 74.43% 193783.82 593 214353 193807.01 186023 201952 30551077 30551077 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 297241 (434744) 23.8% (34.8%) 95.3 3.11sec 1368952 1039344 Direct 95.1 0 937901 937901 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.27 95.07 0.00 0.00 1.3171 0.0000 89170269.95 89170269.95 0.00 1039343.74 1039343.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 95.07 100.00% 937901.41 746400 1148070 936356.55 868062 1005300 89170270 89170270 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 124186 9.9% 50.0 5.83sec 745639 0 Direct 49.8 0 747634 747634 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.96 49.83 0.00 0.00 0.0000 0.0000 37254766.61 37254766.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.83 100.00% 747633.59 594839 914948 746418.37 674150 814115 37254767 37254767 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13317 1.1% 70.9 3.92sec 56347 0 Direct 70.9 45368 92546 56347 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.90 70.90 0.00 0.00 0.0000 0.0000 3994933.96 3994933.96 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.40 76.73% 45368.34 43490 48613 45369.42 43861 47441 2468067 2468067 0.00
crit 16.50 23.27% 92545.83 88720 99170 92547.66 88720 99170 1526867 1526867 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 85200 (156110) 6.8% (12.5%) 72.8 4.06sec 643088 471080 Direct 72.8 244154 702547 350971 23.3%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.82 72.82 0.00 0.00 1.3651 0.0000 25559490.04 25559490.04 0.00 471079.68 471079.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.85 76.70% 244154.37 156239 576325 245324.48 198906 322628 13636582 13636582 0.00
crit 16.97 23.30% 702547.40 448719 1655206 705685.02 463676 1302582 11922908 11922908 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 70910 5.7% 69.9 5.39sec 304309 0 Direct 69.9 211342 608710 304310 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.91 69.91 0.00 0.00 0.0000 0.0000 21272896.08 21272896.08 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.55 76.61% 211341.66 131241 484113 211995.53 150876 317055 11317882 11317882 0.00
crit 16.35 23.39% 608709.61 376924 1390373 610556.06 395750 1178279 9955014 9955014 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 32320 2.6% 16.2 18.23sec 600221 0 Direct 16.0 487076 993635 605976 23.5%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.15 16.00 0.00 0.00 0.0000 0.0000 9696029.49 9696029.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.24 76.52% 487076.02 487076 487076 487076.02 487076 487076 5963588 5963588 0.00
crit 3.76 23.48% 993635.07 993635 993635 975430.95 0 993635 3732441 3732441 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
Terror From Below 50799 4.1% 9.7 29.61sec 1575612 0 Direct 9.7 1266400 2583456 1575653 23.5%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.67 9.67 0.00 0.00 0.0000 0.0000 15240052.72 15240052.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.40 76.52% 1266400.24 1266400 1266400 1266400.24 1266400 1266400 9373408 9373408 0.00
crit 2.27 23.48% 2583456.50 2583456 2583456 2334297.98 0 2583456 5866644 5866644 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 239634 / 156926
Fire Blast 206664 10.8% 86.3 3.39sec 470478 227815 Direct 86.3 381503 763016 470478 23.3%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 86.30 86.30 0.00 0.00 2.0652 0.0000 40603173.29 40603173.29 0.00 227814.63 227814.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.17 76.68% 381503.08 362788 405524 381528.11 373298 392422 25245970 25245970 0.00
crit 20.13 23.32% 763016.19 725575 811049 763075.06 737687 799214 15357203 15357203 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 32971 1.7% 10.1 31.01sec 639739 445944 Direct 10.1 112849 225655 139108 23.3%  
Periodic 101.3 40538 81070 50008 23.4% 67.5%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.12 10.12 101.33 101.33 1.4347 1.9998 6475547.47 6475547.47 0.00 29818.56 445943.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.77 76.72% 112848.81 107493 120155 112857.60 107493 120155 876321 876321 0.00
crit 2.36 23.28% 225654.71 214985 240311 210495.46 0 240311 531799 531799 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.7 76.64% 40538.23 13955 45058 40540.14 39058 42281 3148032 3148032 0.00
crit 23.7 23.36% 81070.02 17928 90117 81071.52 67478 87810 1919395 1919395 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 178007 / 23736
Lightning Blast 178007 1.9% 37.0 7.04sec 192440 184177 Direct 37.0 155828 311755 192444 23.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7120267.34 7120267.34 0.00 184176.60 184176.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.31 76.52% 155827.91 149295 166882 155828.28 151060 163604 4411763 4411763 0.00
crit 8.69 23.48% 311755.28 298591 333765 311714.90 0 333765 2708504 2708504 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Terror
Ascendance 2.0 186.09sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 100.56sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.93 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.82sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.1sec 50.1sec 26.98% 46.31% 0.0(0.0) 5.7

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.21% 32.21% 3.1(3.1) 8.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.1 50.5 4.5sec 2.5sec 68.76% 73.23% 50.5(58.8) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:29.10%
  • elemental_focus_2:39.66%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 7.98% 23.48% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.91% 29.91% 4.2(4.2) 12.6

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.8sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.8sec 19.7sec 37.53% 34.17% 5.9(16.2) 0.7

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.23%
  • power_of_the_maelstrom_2:6.22%
  • power_of_the_maelstrom_3:25.08%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.08% 16.08% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.38% 11.34% 0.0(0.0) 0.2

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.22%
  • stormkeeper_2:3.09%
  • stormkeeper_3:4.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.28% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.7 84.0sec
Lava Surge: During Lava Burst 7.5 35.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6760.0017.4362.2620.00010.063
Fire Elemental0.4330.0011.4810.6330.0003.733
Ascendance6.3760.00173.8336.3020.00073.833
Lava Burst0.8180.0009.9225.4850.00025.118

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Terror
earth_shock Maelstrom 49.2 4963.3 100.9 100.9 16685.1
flame_shock Maelstrom 11.3 207.6 18.3 18.3 171450.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.27 1118.46 (21.40%) 11.74 24.81 2.17%
Lava Burst Overload Maelstrom 49.96 427.52 (8.18%) 8.56 22.16 4.93%
Lightning Bolt Maelstrom 72.82 582.56 (11.14%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 69.90 416.55 (7.97%) 5.96 2.87 0.68%
Aftershock Maelstrom 60.53 1551.28 (29.68%) 25.63 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.92 (5.57%) 0.97 7.66 2.56%
The Deceiver's Blood Pact Maelstrom 9.85 840.18 (16.07%) 85.26 154.20 15.51%
Resource RPS-Gain RPS-Loss
Maelstrom 17.42 17.24
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.93 10.70 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Thurible + Terror Damage Per Second
Count 24999
Mean 1249319.08
Minimum 1033875.48
Maximum 1566563.72
Spread ( max - min ) 532688.24
Range [ ( max - min ) / 2 * 100% ] 21.32%
Standard Deviation 67626.3954
5th Percentile 1140694.45
95th Percentile 1363173.53
( 95th Percentile - 5th Percentile ) 222479.08
Mean Distribution
Standard Deviation 427.7154
95.00% Confidence Intervall ( 1248480.78 - 1250157.39 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11256
0.1 Scale Factor Error with Delta=300 39040570
0.05 Scale Factor Error with Delta=300 156162280
0.01 Scale Factor Error with Delta=300 3904056985
Priority Target DPS
Sample Data Thurible + Terror Priority Target Damage Per Second
Count 24999
Mean 1249319.08
Minimum 1033875.48
Maximum 1566563.72
Spread ( max - min ) 532688.24
Range [ ( max - min ) / 2 * 100% ] 21.32%
Standard Deviation 67626.3954
5th Percentile 1140694.45
95th Percentile 1363173.53
( 95th Percentile - 5th Percentile ) 222479.08
Mean Distribution
Standard Deviation 427.7154
95.00% Confidence Intervall ( 1248480.78 - 1250157.39 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 113
0.1% Error 11256
0.1 Scale Factor Error with Delta=300 39040570
0.05 Scale Factor Error with Delta=300 156162280
0.01 Scale Factor Error with Delta=300 3904056985
DPS(e)
Sample Data Thurible + Terror Damage Per Second (Effective)
Count 24999
Mean 1249319.08
Minimum 1033875.48
Maximum 1566563.72
Spread ( max - min ) 532688.24
Range [ ( max - min ) / 2 * 100% ] 21.32%
Damage
Sample Data Thurible + Terror Damage
Count 24999
Mean 320593362.34
Minimum 257926723.93
Maximum 402951905.24
Spread ( max - min ) 145025181.30
Range [ ( max - min ) / 2 * 100% ] 22.62%
DTPS
Sample Data Thurible + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.93 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.44 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.08 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 19.33 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.35 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 95.57 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.81 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 29.86 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.41 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 48.42 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGPPPEKKKKHKKKKKHKKKKKHKOOMOPKMPLPPPPKMPPPPKMPPPMKPPIPMKPLPPMKKKOMOKMK97OPMPKPPMPKPLMPPKKMPPNPKMPPPMIKKLPPKMPPPMPKPPMPKKMMOOKMLOPPKKMPPPKMKHKKKKGKKHIJJJKKHK9EKKKKHKKKKHKKKLMOOOKMNPKMKKPMPPPKKMOLOKKIJHKPMKMPPPMKPPMPPKPLPMPKKPMPPKMPPPPKMHHPK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:03.106 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:04.245 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.101 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.956 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.811 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:07.666 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:07.666 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.3/125: 56% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:08.805 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:09.924 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:10.762 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.3/125: 87% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:11.880 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.3/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:12.719 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:13.840 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.9/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:14.957 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:16.096 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.9/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.236 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.9/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:18.376 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:19.216 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:20.334 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:21.452 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:22.292 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:23.411 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:24.528 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:25.367 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:26.205 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:27.323 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:28.440 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:29.278 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.5/125: 32% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:30.395 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.512 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.627 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:33.464 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.2/125: 23% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:34.582 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:35.419 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.2/125: 19% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:36.536 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:37.654 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.2/125: 34% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:38.773 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:39.889 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.2/125: 53% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:41.007 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.2/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.096 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.575 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.2/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:45.056 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:46.536 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.014 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.495 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.2/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.606 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.086 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.565 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.044 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:56.133 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.5/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:57.586 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:59.035 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:00.487 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.576 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.687 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.798 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.279 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.4/125: 32% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.391 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.504 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.616 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.098 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.208 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.4/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.319 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.4/125: 33% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.431 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:14.912 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.393 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.4/125: 69% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:17.505 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.985 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.2/125: 34% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:20.096 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.208 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.688 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.800 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:23.800 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.280 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:26.760 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:27.873 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:29.355 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:30.834 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:32.316 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:33.797 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:34.908 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:36.389 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:37.869 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.1/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:39.347 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.1/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:40.457 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.1/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:41.549 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.7/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:43.000 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:44.451 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:45.541 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:46.994 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.104 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.585 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.066 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.820 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.303 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.785 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.4/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.899 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.381 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
1:58.862 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
2:00.344 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:01.456 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 29.9/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.684 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.165 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.275 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.388 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.9/125: 36% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.499 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.611 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.9/125: 60% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:10.093 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:11.205 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:12.316 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.797 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.3/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.277 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.3/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.388 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.6/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:17.870 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.6/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:19.350 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:20.802 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.6/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:22.254 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.6/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:23.343 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.1/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:24.793 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:26.244 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:27.332 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.1/125: 67% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:28.421 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.3/125: 88% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
2:29.512 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:30.993 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.472 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:33.952 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.3/125: 72% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:35.063 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:36.175 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.3/125: 20% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.657 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.138 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.620 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.3/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:42.101 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.215 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:44.327 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.1/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.809 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:47.290 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:48.769 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.249 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.1/125: 65% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.360 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.4/125: 92% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.472 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.584 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.066 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.516 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:57.969 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.421 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.510 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.600 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:03.080 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:04.170 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.257 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.346 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.435 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.524 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.7/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.976 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.7/125: 90% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.086 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.196 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.676 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.789 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.789 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.269 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.749 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:19.230 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:20.710 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:21.822 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:22.910 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.363 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:25.814 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.905 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.993 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.445 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.925 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.404 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.515 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.627 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:36.106 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.586 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.4/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.065 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.543 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.4/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.656 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.410 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:43.892 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:45.004 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:46.117 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.229 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.708 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:50.160 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.1/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
3:51.250 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:52.700 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:54.152 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:55.603 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:56.713 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.8/125: 73% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
3:58.194 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.8/125: 83% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:59.285 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:00.734 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:01.822 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:03.273 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:04.361 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.7/125: 70% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:05.842 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 101.7/125: 81% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.955 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 111.7/125: 89% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.066 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.177 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.289 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:11.401 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:12.513 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.0/125: 79% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.993 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.104 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.215 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.696 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.177 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.9/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.288 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.8/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.770 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.8/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.249 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.729 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.8/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.840 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.8/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.321 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:28.802 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.8/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:30.285 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.8/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:31.765 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.8/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.876 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.8/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.358 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.8/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.470 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:36.950 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:38.040 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.3/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:39.491 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:40.943 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.032 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.483 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:44.964 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:46.446 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.558 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.039 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.521 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.3/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.001 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:53.453 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:54.906 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:55.994 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:57.084 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:58.173 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.653 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.63
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Thurible + Tome : 1255146 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1255146.5 1255146.5 847.8 / 0.068% 265521.1 / 21.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 49.5 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Thurible + Tome 1255146
Earth Shock 284229 22.6% 49.2 5.89sec 1731823 1619284 Direct 49.2 1229615 3550956 1731740 21.6%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.24 49.24 0.00 0.00 1.0695 0.0000 85268251.17 85268251.17 0.00 1619283.89 1619283.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.58 78.37% 1229614.85 764282 1669015 1229087.03 1042086 1439094 47443501 47443501 0.00
crit 10.65 21.63% 3550955.95 2195018 4793412 3549321.55 2548229 4588893 37824750 37824750 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 123837 9.9% 11.3 27.12sec 3280542 3146068 Direct 11.3 92724 270992 221291 72.1%  
Periodic 211.8 51117 204080 163556 73.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 211.83 211.83 1.0428 1.4075 37151913.08 37151913.08 0.00 119863.05 3146067.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.16 27.88% 92723.71 83107 101633 92431.45 0 99668 292733 292733 0.00
crit 8.17 72.12% 270991.61 238684 291889 271056.10 256533 282850 2213440 2213440 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.1 26.49% 51116.51 218 55899 51125.52 47794 53146 2868638 2868638 0.00
crit 155.7 73.51% 204080.01 127 224759 204106.73 196222 211508 31777103 31777103 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 15110 1.2% 5.1 60.41sec 883220 0 Periodic 47.0 79716 162804 96391 20.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.13 0.00 47.03 47.03 0.0000 1.2767 4532831.28 4532831.28 0.00 75501.89 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.6 79.93% 79716.41 11241 86414 79717.50 74997 86414 2996346 2996346 0.00
crit 9.4 20.07% 162804.44 22931 176284 162809.06 22931 176284 1536485 1536485 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:69081.05
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 311259 (455171) 24.8% (36.3%) 95.1 3.14sec 1435780 1090167 Direct 94.9 0 983852 983852 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.11 94.91 0.00 0.00 1.3170 0.0000 93376837.62 93376837.62 0.00 1090166.91 1090166.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 94.91 100.00% 983852.04 786904 1246219 982416.17 915326 1055306 93376838 93376838 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 130045 10.4% 49.9 5.91sec 782068 0 Direct 49.8 0 784172 784172 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.88 49.75 0.00 0.00 0.0000 0.0000 39012948.38 39012948.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.75 100.00% 784171.83 627119 993167 783036.05 709200 848064 39012948 39012948 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13867 1.1% 70.9 3.97sec 58659 0 Direct 70.9 47725 97384 58660 22.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.92 70.92 0.00 0.00 0.0000 0.0000 4160160.86 4160160.86 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.31 77.98% 47725.36 45850 50972 47725.25 45959 49707 2639507 2639507 0.00
crit 15.61 22.02% 97383.97 93534 103984 97381.50 93534 103984 1520653 1520653 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 86884 (159043) 6.9% (12.7%) 73.0 4.02sec 653594 478799 Direct 73.0 257074 730051 357052 21.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.00 73.00 0.00 0.00 1.3651 0.0000 26064815.26 26064815.26 0.00 478799.47 478799.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.57 78.86% 257073.68 164718 604304 258335.42 209002 357284 14799201 14799201 0.00
crit 15.43 21.14% 730051.07 473069 1735560 733204.43 492565 1594672 11265614 11265614 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 72158 5.7% 70.1 5.33sec 308878 0 Direct 70.1 222376 632543 308860 21.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.08 70.08 0.00 0.00 0.0000 0.0000 21647072.92 21647072.92 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.30 78.91% 222375.65 138363 507615 223058.51 163110 320115 12297600 12297600 0.00
crit 14.78 21.09% 632543.07 397378 1457871 634585.29 416316 1337810 9349473 9349473 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31919 2.5% 16.2 18.09sec 591545 0 Direct 16.0 487076 993635 597197 21.7%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.19 16.03 0.00 0.00 0.0000 0.0000 9575766.78 9575766.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.55 78.26% 487076.02 487076 487076 487076.02 487076 487076 6112055 6112055 0.00
crit 3.49 21.74% 993635.07 993635 993635 968514.97 0 993635 3463712 3463712 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 248714 / 161522
Fire Blast 214439 11.1% 85.6 3.41sec 487897 236375 Direct 85.6 401246 802577 487898 21.6%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.64 85.64 0.00 0.00 2.0641 0.0000 41781390.86 41781390.86 0.00 236374.90 236374.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.15 78.41% 401246.14 382475 425211 401269.71 393229 413463 26942070 26942070 0.00
crit 18.49 21.59% 802576.80 764949 850423 802629.99 770927 837273 14839321 14839321 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34276 1.8% 10.0 31.21sec 664693 463428 Direct 10.0 118677 237505 144920 22.1%  
Periodic 100.7 42650 85222 51863 21.6% 67.1%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.04 10.04 100.66 100.66 1.4344 1.9990 6676147.91 6676147.91 0.00 30962.28 463428.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.83 77.92% 118676.51 113326 125989 118685.56 113326 125989 928804 928804 0.00
crit 2.22 22.08% 237504.56 226652 251977 218498.29 0 251977 526705 526705 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.9 78.36% 42650.23 14679 47246 42651.59 41334 44548 3364044 3364044 0.00
crit 21.8 21.64% 85222.22 29358 94491 85222.69 72374 92233 1856595 1856595 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182354 / 24316
Lightning Blast 182354 1.9% 37.0 7.03sec 197140 188670 Direct 37.0 163944 327928 197140 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 7294170.98 7294170.98 0.00 188670.00 188670.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.51 79.76% 163943.89 157397 174984 163942.64 159088 171016 4838027 4838027 0.00
crit 7.49 20.24% 327928.20 314794 349968 327842.21 0 349968 2456144 2456144 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Thurible + Tome
Ascendance 2.0 186.31sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 101.90sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.89 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Thurible + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.65sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8837 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.82sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.3sec 50.3sec 26.83% 46.15% 0.0(0.0) 5.6

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.0sec 32.19% 32.19% 3.0(3.0) 8.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.4 49.0 4.5sec 2.6sec 67.46% 72.12% 49.0(56.7) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.85%
  • elemental_focus_2:38.61%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.1sec 60.1sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.5 0.7 14.0sec 13.5sec 7.99% 23.55% 0.7(0.7) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.99%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 29.97% 29.97% 4.3(4.3) 12.6

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.1sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.8sec 19.7sec 37.54% 34.11% 5.9(16.1) 0.7

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.25%
  • power_of_the_maelstrom_2:6.28%
  • power_of_the_maelstrom_3:25.01%

Trigger Attempt Success

  • trigger_pct:15.00%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.11% 16.11% 0.0(0.0) 16.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.11%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.37% 11.32% 0.0(0.0) 0.2

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.22%
  • stormkeeper_2:3.09%
  • stormkeeper_3:4.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 96.59% 2.0(2.0) 0.0

Buff details

  • buff initial source:Thurible + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.2 13.5sec
Lava Surge: Wasted 0.7 85.2sec
Lava Surge: During Lava Burst 7.5 35.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6740.0018.8842.2590.00010.636
Fire Elemental0.4220.0011.4810.6100.0003.858
Ascendance6.2810.00164.6276.2100.00064.627
Lava Burst0.8190.00012.2165.4850.00021.627

Resources

Resource Usage Type Count Total Average RPE APR
Thurible + Tome
earth_shock Maelstrom 49.2 4964.2 100.8 100.8 17176.5
flame_shock Maelstrom 11.3 207.5 18.3 18.3 179047.8
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.11 1116.48 (21.35%) 11.74 24.78 2.17%
Lava Burst Overload Maelstrom 49.89 426.65 (8.16%) 8.55 22.31 4.97%
Lightning Bolt Maelstrom 73.00 583.99 (11.17%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.08 417.66 (7.99%) 5.96 2.82 0.67%
Aftershock Maelstrom 60.56 1551.52 (29.67%) 25.62 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.92 (5.56%) 0.97 7.66 2.57%
The Deceiver's Blood Pact Maelstrom 9.87 841.18 (16.09%) 85.23 154.12 15.49%
Resource RPS-Gain RPS-Loss
Maelstrom 17.43 17.24
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.58 9.80 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Thurible + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Thurible + Tome Damage Per Second
Count 24999
Mean 1255146.50
Minimum 1039910.69
Maximum 1521325.30
Spread ( max - min ) 481414.61
Range [ ( max - min ) / 2 * 100% ] 19.18%
Standard Deviation 68396.0833
5th Percentile 1147414.61
95th Percentile 1371453.09
( 95th Percentile - 5th Percentile ) 224038.48
Mean Distribution
Standard Deviation 432.5835
95.00% Confidence Intervall ( 1254298.65 - 1255994.34 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11407
0.1 Scale Factor Error with Delta=300 39934306
0.05 Scale Factor Error with Delta=300 159737222
0.01 Scale Factor Error with Delta=300 3993430534
Priority Target DPS
Sample Data Thurible + Tome Priority Target Damage Per Second
Count 24999
Mean 1255146.50
Minimum 1039910.69
Maximum 1521325.30
Spread ( max - min ) 481414.61
Range [ ( max - min ) / 2 * 100% ] 19.18%
Standard Deviation 68396.0833
5th Percentile 1147414.61
95th Percentile 1371453.09
( 95th Percentile - 5th Percentile ) 224038.48
Mean Distribution
Standard Deviation 432.5835
95.00% Confidence Intervall ( 1254298.65 - 1255994.34 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 115
0.1% Error 11407
0.1 Scale Factor Error with Delta=300 39934306
0.05 Scale Factor Error with Delta=300 159737222
0.01 Scale Factor Error with Delta=300 3993430534
DPS(e)
Sample Data Thurible + Tome Damage Per Second (Effective)
Count 24999
Mean 1255146.50
Minimum 1039910.69
Maximum 1521325.30
Spread ( max - min ) 481414.61
Range [ ( max - min ) / 2 * 100% ] 19.18%
Damage
Sample Data Thurible + Tome Damage
Count 24999
Mean 320790597.34
Minimum 258193907.56
Maximum 397278146.72
Spread ( max - min ) 139084239.16
Range [ ( max - min ) / 2 * 100% ] 21.68%
DTPS
Sample Data Thurible + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Thurible + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Thurible + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Thurible + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Thurible + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Thurible + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Thurible + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Thurible + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.89 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.13 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 19.29 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.31 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 95.40 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.80 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 29.95 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.48 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 48.56 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLKHKKLFLLLLILLLLLILLLLNPPNPQQLLIMQQQQLNQQQNLLLLLILLNQAJQQMLLNQQQLNQQQQLNQQ97QLNQQLMLQNLQQLNQQOQNLQQQNALJIMQQQLNQQQQLNQQQLLLILQQNLLLLLLGILLPNPLNPLLHQNAQLJLLK9KIKLFLLLIILLLLLILLMPPNPLNNOPPPLNQQQNLQMLLALLIJKKKLILQNQQLLNLQQNLMQQQQLNQQQLNQQQQL9NIQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Thurible + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.966 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:03.107 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:03.963 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:04.819 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.3/125: 17% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.675 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.531 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.670 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.811 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.951 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.3/125: 72% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.090 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.228 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.082 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.221 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:15.338 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:16.457 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:17.575 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:18.693 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:19.530 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:20.646 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:21.786 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:22.927 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:24.067 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:24.922 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:26.061 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.201 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.056 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.196 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.313 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.432 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.550 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:33.388 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:34.227 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:35.066 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:36.204 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.343 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.481 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.5/125: 47% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.621 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.761 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.617 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.099 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.582 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.063 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.173 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.1/125: 22% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.654 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.1/125: 33% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.134 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.615 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:53.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.1/125: 80% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:54.516 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.1/125: 98% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:55.606 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:57.059 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.7/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:58.512 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
0:59.604 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.055 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:01.055 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:02.145 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:03.233 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:04.323 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
1:05.415 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
1:06.865 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.976 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.086 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:10.176 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.7/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:11.628 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:13.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
1:14.532 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
1:15.645 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity
1:17.125 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.1/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity, mark_of_the_claw
1:18.577 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:20.029 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:21.480 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:22.933 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:24.023 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.5/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
1:25.475 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.926 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.017 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:28.017 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.466 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:30.917 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:32.030 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.9/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.509 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.990 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.101 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 69.9/125: 56% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.212 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.692 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.9/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.175 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.9/125: 64% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.286 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.6/125: 25% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.398 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:43.852 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.6/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:45.303 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.6/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:46.754 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:47.845 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.326 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.805 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 54.2/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.560 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.040 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.2/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:54.151 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.2/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:55.635 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:57.115 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.595 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:00.075 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:01.186 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:01.186 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
2:02.666 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 113.0/125: 90% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.776 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.0/125: 98% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.888 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.999 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.9/125: 21% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.112 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.223 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.336 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.817 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.928 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.3/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.409 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.3/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:14.888 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:16.369 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:17.851 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:19.332 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:20.445 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, potion_of_prolonged_power
2:21.925 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:23.377 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:24.829 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.3/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
2:25.919 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
2:27.370 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:28.483 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:29.594 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.707 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:32.187 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.668 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:35.894 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.3/125: 35% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:37.376 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.3/125: 46% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:38.856 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:40.336 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.3/125: 75% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:41.447 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:42.927 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.037 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.0/125: 97% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:45.147 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.627 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:48.108 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:49.588 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.3/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.698 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:52.179 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:53.269 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:54.358 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:55.809 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:56.898 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:58.350 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.440 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:00.891 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:02.003 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:02.003 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:03.483 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:04.593 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.706 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.186 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.298 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 96.8/125: 77% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.410 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 111.8/125: 89% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.519 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 112.8/125: 90% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.631 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.742 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:13.853 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.334 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:15.334 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:16.786 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity, mark_of_the_claw
3:18.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:19.328 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:20.418 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:21.508 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:22.987 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:24.469 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:25.921 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
3:27.371 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:28.459 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.549 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:31.000 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:32.480 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:33.569 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:35.020 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:36.472 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:37.562 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
3:39.015 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:40.496 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.4/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.608 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:42.721 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.475 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.955 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.435 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.916 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.1/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.397 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.509 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.990 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.471 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:54.952 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.063 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.4/125: 21% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.543 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.4/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:59.023 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.134 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.615 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.4/125: 47% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.097 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:03.097 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.576 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.4/125: 83% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:06.054 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:07.165 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:08.276 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:09.390 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:10.501 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.591 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.041 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:14.129 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.2/125: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:15.580 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:17.062 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:18.150 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:19.602 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, mark_of_the_claw
4:21.054 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity, mark_of_the_claw
4:22.506 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw
4:23.595 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.6/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:24.707 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
4:25.819 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, extracted_sanity
4:27.300 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:28.780 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:29.891 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.8/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:31.372 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.483 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.8/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:33.963 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:35.442 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
4:36.923 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.8/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.403 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.8/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:39.882 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.8/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:40.994 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.2/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
4:42.475 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:43.955 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.2/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.435 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.916 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.2/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.027 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.6/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.506 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.987 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.468 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.947 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.428 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 90.6/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.518 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.6/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.608 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.698 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 61081 58850 48722 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 61081 58850 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 939.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Thurible + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=spectral_thurible,id=147018,ilevel=930
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.25
# gear_stamina=46429
# gear_intellect=48722
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Charm : 1295275 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1295274.7 1295274.7 963.8 / 0.074% 304218.8 / 23.5% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 52.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Charm 1295275
Earth Shock 297229 22.9% 52.7 5.50sec 1692471 1684429 Direct 52.7 1231852 3534869 1692544 20.0%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.69 52.69 0.00 0.00 1.0048 0.0000 89168610.84 89168610.84 0.00 1684428.87 1684428.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.15 80.00% 1231852.22 770237 1676408 1231484.83 1036031 1468234 51921447 51921447 0.00
crit 10.54 20.00% 3534868.74 2212121 4814645 3532599.21 2536321 4625003 37247164 37247164 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 136217 10.5% 11.3 27.10sec 3608643 3584440 Direct 11.3 93438 272112 226327 74.4%  
Periodic 227.1 51522 206003 168663 75.8% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.32 11.32 227.10 227.10 1.0068 1.3129 40866199.06 40866199.06 0.00 132013.82 3584439.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.90 25.62% 93438.25 83755 102083 92801.31 0 102083 271116 271116 0.00
crit 8.42 74.38% 272111.72 240544 293182 272160.72 259067 284242 2291992 2291992 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.9 24.17% 51521.69 240 56147 51532.40 47961 53403 2828034 2828034 0.00
crit 172.2 75.83% 206002.63 384 225754 206010.77 194527 213434 35475057 35475057 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 334458 (488976) 25.8% (37.8%) 102.2 2.93sec 1434740 1171865 Direct 102.0 0 983389 983389 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.24 102.03 0.00 0.00 1.2243 0.0000 100337308.49 100337308.49 0.00 1171864.53 1171864.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 102.03 100.00% 983388.83 793035 1177240 981858.00 917071 1045510 100337308 100337308 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 139798 10.8% 53.7 5.53sec 781699 0 Direct 53.5 0 783716 783716 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 53.65 53.51 0.00 0.00 0.0000 0.0000 41939629.26 41939629.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 53.51 100.00% 783715.88 632005 938195 782505.74 708743 842971 41939629 41939629 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14720 1.1% 76.1 3.72sec 58030 0 Direct 76.1 48035 97991 58031 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.10 76.10 0.00 0.00 0.0000 0.0000 4415892.49 4415892.49 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.87 79.99% 48035.11 46207 51198 48035.90 46635 49915 2923931 2923931 0.00
crit 15.23 20.01% 97990.62 94262 104444 97991.01 94262 104444 1491961 1491961 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 90816 (165443) 7.0% (12.8%) 78.1 3.72sec 635235 495967 Direct 78.1 253024 730411 348688 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.13 78.13 0.00 0.00 1.2808 0.0000 27244058.30 27244058.30 0.00 495967.42 495967.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.47 79.96% 253023.68 166001 606980 254309.85 208267 335115 15807659 15807659 0.00
crit 15.66 20.04% 730411.33 476754 1743248 733770.97 503023 1341578 11436399 11436399 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74628 5.8% 74.0 4.99sec 302620 0 Direct 74.0 219784 632505 302614 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.98 73.98 0.00 0.00 0.0000 0.0000 22387897.85 22387897.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.13 79.93% 219784.23 139441 509864 220506.58 163949 323384 12996477 12996477 0.00
crit 14.85 20.07% 632505.17 400474 1464328 634779.41 417646 1245376 9391421 9391421 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 266890 / 181694
Fire Blast 231006 12.1% 97.4 3.04sec 484384 253963 Direct 97.4 403373 806780 484388 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.41 97.41 0.00 0.00 1.9073 0.0000 47183539.93 47183539.93 0.00 253963.04 253963.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 77.85 79.92% 403372.71 385455 427095 403411.79 395434 414710 31401776 31401776 0.00
crit 19.56 20.08% 806779.57 770910 854190 806860.95 778481 842508 15781764 15781764 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 35885 1.9% 10.5 30.20sec 700112 512841 Direct 10.5 119339 238673 143356 20.1%  
Periodic 113.2 42861 85744 51474 20.1% 69.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.46 10.46 113.18 113.18 1.3652 1.8528 7325931.34 7325931.34 0.00 32706.51 512840.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.36 79.88% 119339.33 114209 126547 119349.29 115158 126547 997525 997525 0.00
crit 2.11 20.12% 238673.45 228418 253093 215854.96 0 253093 502461 502461 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.5 79.92% 42860.53 19 47455 42865.36 41084 44735 3876765 3876765 0.00
crit 22.7 20.08% 85744.50 41 94910 85748.89 67274 92374 1949181 1949181 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 192848 / 25715
Lightning Blast 192848 2.0% 38.9 6.63sec 198156 203507 Direct 38.9 164962 330008 198155 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.93 38.93 0.00 0.00 0.9737 0.0000 7713915.71 7713915.71 0.00 203506.55 203506.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.10 79.89% 164961.85 158623 175759 164961.24 160205 172154 5130155 5130155 0.00
crit 7.83 20.11% 330008.01 317247 351518 329990.48 0 351518 2583761 2583761 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Charm
Ascendance 2.0 184.78sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Charm
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 97.37sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 1.0566 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Charm
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Charm
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.59sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8532 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.61sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5077 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.0 0.0 49.3sec 49.3sec 27.96% 49.21% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.0sec 32.20% 32.20% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.1sec 69.1sec 8.66% 8.66% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 68.2 54.0 4.4sec 2.4sec 66.75% 70.42% 54.0(61.5) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.53%
  • elemental_focus_2:38.21%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.9 0.8 13.2sec 12.7sec 8.12% 23.70% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.12%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.91% 29.91% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.4sec 69.4sec 13.46% 13.46% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.46%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 82.1sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.7 6.7 34.0sec 18.4sec 38.20% 32.89% 6.7(18.6) 0.6

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.02%
  • power_of_the_maelstrom_2:6.03%
  • power_of_the_maelstrom_3:26.15%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Rising Tides 4.0 0.0 90.5sec 90.5sec 26.67% 26.67% 44.0(44.0) 4.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_rising_tides
  • max_stacks:10
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:643.89

Stack Uptimes

  • rising_tides_1:1.33%
  • rising_tides_2:1.33%
  • rising_tides_3:1.33%
  • rising_tides_4:1.33%
  • rising_tides_5:1.33%
  • rising_tides_6:1.33%
  • rising_tides_7:1.33%
  • rising_tides_8:1.33%
  • rising_tides_9:1.33%
  • rising_tides_10:14.67%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242458
  • name:Rising Tides
  • tooltip:Haste increased by $w2.
  • description:While you remain stationary, gain {$s2=414} Haste every $t1 sec stacking up to {$u=10} times. Lasts {$d=20 seconds}.
  • max_stacks:10
  • duration:20.00
  • cooldown:90.00
  • default_chance:101.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 9.81% 10.55% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:2.99%
  • stormkeeper_2:2.95%
  • stormkeeper_3:3.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 99.07% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Charm
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.6 12.7sec
Lava Surge: Wasted 0.8 85.6sec
Lava Surge: During Lava Burst 8.0 33.4sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6210.0006.5202.1400.00010.602
Fire Elemental0.3970.0011.7390.5870.0003.680
Ascendance5.5050.00177.8265.3930.00077.826
Lava Burst0.7750.00010.2895.1400.00024.428

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Charm
earth_shock Maelstrom 52.7 5300.4 100.6 100.6 16823.0
flame_shock Maelstrom 11.3 207.5 18.3 18.3 196958.0
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 102.24 1198.65 (21.54%) 11.72 28.21 2.30%
Lava Burst Overload Maelstrom 53.65 459.44 (8.26%) 8.56 23.43 4.85%
Lightning Bolt Maelstrom 78.14 625.09 (11.23%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 73.98 441.02 (7.93%) 5.96 2.86 0.65%
Aftershock Maelstrom 64.01 1652.36 (29.70%) 25.81 0.00 0.00%
Resonance Totem Maelstrom 298.58 291.01 (5.23%) 0.97 7.58 2.54%
The Deceiver's Blood Pact Maelstrom 10.55 896.55 (16.11%) 85.01 164.60 15.51%
Resource RPS-Gain RPS-Loss
Maelstrom 18.55 18.36
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.94 9.80 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Charm Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Whispers + Charm Damage Per Second
Count 24999
Mean 1295274.70
Minimum 1041358.65
Maximum 1605415.17
Spread ( max - min ) 564056.52
Range [ ( max - min ) / 2 * 100% ] 21.77%
Standard Deviation 77750.8902
5th Percentile 1171663.15
95th Percentile 1426461.79
( 95th Percentile - 5th Percentile ) 254798.64
Mean Distribution
Standard Deviation 491.7496
95.00% Confidence Intervall ( 1294310.89 - 1296238.51 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 139
0.1% Error 13842
0.1 Scale Factor Error with Delta=300 51605313
0.05 Scale Factor Error with Delta=300 206421249
0.01 Scale Factor Error with Delta=300 5160531209
Priority Target DPS
Sample Data Whispers + Charm Priority Target Damage Per Second
Count 24999
Mean 1295274.70
Minimum 1041358.65
Maximum 1605415.17
Spread ( max - min ) 564056.52
Range [ ( max - min ) / 2 * 100% ] 21.77%
Standard Deviation 77750.8902
5th Percentile 1171663.15
95th Percentile 1426461.79
( 95th Percentile - 5th Percentile ) 254798.64
Mean Distribution
Standard Deviation 491.7496
95.00% Confidence Intervall ( 1294310.89 - 1296238.51 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 139
0.1% Error 13842
0.1 Scale Factor Error with Delta=300 51605313
0.05 Scale Factor Error with Delta=300 206421249
0.01 Scale Factor Error with Delta=300 5160531209
DPS(e)
Sample Data Whispers + Charm Damage Per Second (Effective)
Count 24999
Mean 1295274.70
Minimum 1041358.65
Maximum 1605415.17
Spread ( max - min ) 564056.52
Range [ ( max - min ) / 2 * 100% ] 21.77%
Damage
Sample Data Whispers + Charm Damage
Count 24999
Mean 326359596.28
Minimum 254294031.44
Maximum 413424688.22
Spread ( max - min ) 159130656.77
Range [ ( max - min ) / 2 * 100% ] 24.38%
DTPS
Sample Data Whispers + Charm Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Charm Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Charm Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Charm Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Charm Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Charm Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + CharmTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Charm Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 4.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.49 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.06 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.73 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 102.54 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.78 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 31.95 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 19.18 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 52.98 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQQQLFLLLILLLLLILLLLLILLNNPPPLNILQLMPNPPLNNILLLLLIILLJKKKILLLLLIGLL97LLNPPPNQLLNAQQQLNMQQQLLNPPNPOLLNLQQNLQJMQQQLLNIQQQLNLQQQNQLPNPPLNMQQQLQNQQQLNQQQNLPHPAPNI9JLLQNLIKKFLLLILLLLILLLLLMNPPPLNQOQQLLNLPPNIILLLLLILLGJKKKIILLLLLILLQNQMAQQLLLNQQLL9NPPPNLLNQQQQNLQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Charm 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Charm 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Charm 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
0:01.957 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides
0:03.061 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(2)
0:03.881 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(3)
0:04.689 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(4)
0:05.754 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(5)
0:06.544 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
0:07.322 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.3/125: 45% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:08.093 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
0:09.121 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(9)
0:09.875 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(9)
0:09.875 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(9)
0:10.879 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power, rising_tides(10)
0:11.888 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:12.898 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:13.657 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:14.416 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:15.427 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:16.186 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:17.196 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:18.205 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.5/125: 97% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:18.964 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:19.972 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.8/125: 47% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:20.982 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.8/125: 57% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
0:21.990 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.8/125: 75% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.132 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.8/125: 93% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.271 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.127 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.265 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.405 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.260 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.115 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.2/125: 24% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.256 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.396 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.2/125: 48% maelstrom bloodlust, lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.535 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.2/125: 65% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.389 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.2/125: 85% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:34.228 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:35.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:36.185 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:37.302 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom bloodlust, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.140 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.978 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.117 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.972 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.112 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.594 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.076 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.9/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.188 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.7/125: 91% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.300 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.411 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:49.890 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.370 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.852 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.332 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.812 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.924 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.035 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.516 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.997 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.109 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.224 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:04.334 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.446 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:07.565 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:08.574 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:09.583 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:10.593 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:11.604 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:12.362 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:13.121 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:14.132 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:15.142 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
1:15.902 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:15.902 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:16.931 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
1:17.960 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:19.266 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:21.006 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:22.745 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.7/125: 47% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:24.486 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
1:25.793 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.275 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.386 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.867 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.979 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:30.979 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides
1:32.442 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(2)
1:33.885 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(3)
1:35.309 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(5)
1:36.698 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(6)
1:37.710 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(7)
1:38.710 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.3/125: 16% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(8)
1:40.029 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:41.318 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:42.606 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:43.589 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:44.901 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:45.886 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:47.198 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:48.509 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:49.493 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.9/125: 28% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power, rising_tides(10)
1:50.803 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power, rising_tides(10)
1:51.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:53.006 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:54.096 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:55.185 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:56.274 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.754 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.7/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:59.234 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:00.347 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:01.829 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.310 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.420 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 56.0/125: 45% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.532 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.0/125: 34% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:06.306 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.0/125: 46% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:07.080 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.0/125: 54% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:07.854 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:08.883 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/125: 76% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:09.642 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.0/125: 93% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:10.400 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:11.160 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:12.169 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:13.179 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:14.190 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
2:14.949 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
2:15.722 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.4/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
2:16.753 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.4/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:17.782 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:19.521 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:21.262 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:22.570 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:24.312 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.9/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
2:26.053 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.9/125: 50% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.534 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.9/125: 58% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.647 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.128 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:31.608 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.2/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:33.089 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.2/125: 69% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:34.178 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:35.268 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 14.0/125: 11% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:36.719 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:38.171 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:39.622 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.0/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.101 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:42.552 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:43.642 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:45.093 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.545 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.997 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.1/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:49.477 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.1/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.589 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:52.069 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.551 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.1/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:55.031 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.1/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.142 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.5/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:57.595 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:59.048 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:00.138 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:01.590 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:01.590 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, rising_tides
3:03.023 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(2)
3:04.105 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.4/125: 97% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(3)
3:05.174 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(4)
3:06.230 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(5)
3:07.274 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom lava_surge, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, rising_tides(6)
3:08.305 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.7/125: 42% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(7)
3:09.251 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(8)
3:10.006 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(9)
3:10.760 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.9/125: 78% maelstrom lava_surge, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:11.513 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.9/125: 95% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:12.268 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:13.024 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:13.779 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:13.779 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.3/125: 63% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:14.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.3/125: 73% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, rising_tides(10)
3:15.604 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, rising_tides(10)
3:16.501 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, rising_tides(10)
3:17.257 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, rising_tides(10)
3:18.154 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, rising_tides(10)
3:19.049 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, rising_tides(10)
3:19.945 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, rising_tides(10)
3:21.463 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, rising_tides(10)
3:22.601 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:24.307 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:26.049 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:27.789 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.6/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:29.269 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.6/125: 80% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.752 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.6/125: 91% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.863 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.6/125: 88% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.975 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:34.457 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:35.935 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.417 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:38.898 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.6/125: 85% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.012 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.462 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:42.217 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.668 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.119 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:46.209 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.688 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.4/125: 90% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.798 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.0/125: 35% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.909 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:51.389 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.870 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.981 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.091 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.202 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.684 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.796 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.276 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.757 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.238 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:04.329 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:05.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.4/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:07.232 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.322 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.411 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 71.4/125: 57% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.521 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 93.4/125: 75% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:11.632 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 108.4/125: 87% maelstrom ascendance, elemental_focus(2), stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.743 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.856 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.967 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:16.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:17.870 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:19.321 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:20.773 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.255 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.367 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.329 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:27.809 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.920 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.400 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 39.0/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.512 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.512 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides
4:32.975 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.0/125: 34% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(2)
4:34.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(3)
4:35.488 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.0/125: 62% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(4)
4:36.894 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/125: 72% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(6)
4:37.925 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.0/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(7)
4:38.946 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.6/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(8)
4:40.289 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(9)
4:41.615 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:42.600 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.6/125: 58% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:43.911 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 85.6/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:44.896 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.6/125: 76% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:45.880 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:47.191 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:48.503 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.1/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:49.814 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:50.798 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, rising_tides(10)
4:52.110 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.9/125: 39% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.222 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:53.998 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:55.026 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:56.055 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:57.086 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.9/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:58.116 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:58.875 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.9/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:59.885 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.9/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63178 60948 50720 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63178 60948 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Charm of the Rising Tide
ilevel: 930, stats: { +2728 Int }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Charm"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=charm_of_the_rising_tide,id=147002,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=50720
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Sentinel : 1288309 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1288309.5 1288309.5 929.9 / 0.072% 292455.9 / 22.7% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.1 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Sentinel 1288309
Earth Shock 285740 22.2% 52.6 5.52sec 1628679 1585988 Direct 52.6 1184256 3399990 1628671 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.63 52.63 0.00 0.00 1.0269 0.0000 85721088.94 85721088.94 0.00 1585988.44 1585988.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 42.08 79.94% 1184255.89 735320 1607822 1183919.51 989483 1375064 49829004 49829004 0.00
crit 10.56 20.06% 3399989.87 2111840 4617666 3399268.29 2217432 4580724 35892085 35892085 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 125477 9.7% 11.3 27.11sec 3323508 3264009 Direct 11.3 89264 260543 215337 73.6%  
Periodic 221.0 49212 197034 159314 74.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.98 220.98 1.0183 1.3493 37643820.31 37643820.31 0.00 121553.62 3264009.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.99 26.39% 89264.23 79958 97906 88819.20 0 97906 266862 266862 0.00
crit 8.34 73.61% 260543.44 229640 281187 260605.10 245478 272429 2172159 2172159 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.4 25.52% 49212.48 98 53849 49221.60 46318 51498 2775039 2775039 0.00
crit 164.6 74.48% 197033.75 138 216518 197046.06 186772 205306 32429761 32429761 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 309914 (471280) 24.1% (36.6%) 99.3 2.98sec 1424228 1125999 Direct 99.1 0 938529 938529 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.27 99.06 0.00 0.00 1.2649 0.0000 92973234.04 92973234.04 0.00 1125998.59 1125998.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 99.06 100.00% 938528.88 757085 1129077 937030.54 868853 1003123 92973234 92973234 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 147711 11.5% 59.4 4.93sec 745976 0 Direct 59.2 0 747980 747980 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 59.40 59.24 0.00 0.00 0.0000 0.0000 44312986.20 44312986.20 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 59.24 100.00% 747979.51 603355 899811 746783.86 685003 815175 44312986 44312986 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 13655 1.1% 73.8 3.79sec 55503 0 Direct 73.8 45941 93704 55502 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.81 73.81 0.00 0.00 0.0000 0.0000 4096414.80 4096414.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.03 79.98% 45941.06 44113 49104 45940.82 44545 47632 2711870 2711870 0.00
crit 14.78 20.02% 93704.18 89990 100172 93702.44 0 99246 1384545 1384545 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 84674 (160120) 6.6% (12.4%) 75.5 3.92sec 636032 488328 Direct 75.5 244337 703341 336327 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.52 75.52 0.00 0.00 1.3025 0.0000 25401924.55 25401924.55 0.00 488328.44 488328.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.39 79.96% 244336.81 158476 582148 245601.25 199966 363521 14754456 14754456 0.00
crit 15.14 20.04% 703341.31 455142 1671928 706617.56 477421 1390771 10647468 10647468 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 75446 5.9% 77.7 4.90sec 291333 0 Direct 77.7 211585 609400 291316 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.69 77.69 0.00 0.00 0.0000 0.0000 22633479.56 22633479.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.12 79.96% 211585.41 133120 489004 212325.50 156390 326623 13143814 13143814 0.00
crit 15.57 20.04% 609400.18 382320 1404419 611639.35 395291 1118613 9489665 9489665 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Spectral Owl 0 (56152) 0.0% (4.4%) 3.0 120.42sec 5614815 0

Stats details: spectral_owl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 60.00 0.00 0.0000 1.0000 0.00 0.00 0.00 280740.76 0.00
 
 

Action details: spectral_owl

Static Values
  • id:242570
  • school:arcane
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242570
  • name:Spectral Owl
  • school:arcane
  • tooltip:A spectral owl is assisting you.
  • description:Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:20.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Spectral Blast 17908 1.4% 36.4 7.35sec 147424 0 Direct 36.4 121869 248614 147424 20.2%  

Stats details: spectral_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.44 36.44 0.00 0.00 0.0000 0.0000 5372074.76 5372074.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.09 79.84% 121869.49 121869 121869 121869.49 121869 121869 3545496 3545496 0.00
crit 7.35 20.16% 248613.77 248614 248614 248494.43 0 248614 1826579 1826579 0.00
 
 

Action details: spectral_blast

Static Values
  • id:246442
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:22.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246442
  • name:Spectral Blast
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:94991.10
  • base_dd_max:104990.16
 
    Spectral Bolt 38244 3.0% 96.2 2.73sec 119276 0 Direct 96.2 98655 201256 119276 20.1%  

Stats details: spectral_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.18 96.18 0.00 0.00 0.0000 0.0000 11472370.83 11472370.83 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.85 79.90% 98654.92 98655 98655 98654.92 98655 98655 7581839 7581839 0.00
crit 19.33 20.10% 201256.04 201256 201256 201256.04 201256 201256 3890531 3890531 0.00
 
 

Action details: spectral_bolt

Static Values
  • id:242571
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:35.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242571
  • name:Spectral Bolt
  • school:arcane
  • tooltip:
  • description:{$@spelldesc242570=Call upon a spectral owl to attack your target, inflicting {$242571s1=23941 to 26461} Arcane damage every $t2 sec for {$d=20 seconds}. Your ranged attacks and spells against the same enemy have a chance to make the owl perform an additional attack for {$246442s1=29575 to 32688} damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:76896.55
  • base_dd_max:84990.92
 
pet - primal_fire_elemental 246521 / 165157
Fire Blast 212974 11.1% 92.3 3.19sec 463617 234514 Direct 92.3 386026 772094 463620 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.34 92.34 0.00 0.00 1.9769 0.0000 42808813.12 42808813.12 0.00 234513.58 234513.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.78 79.90% 386026.41 367981 409621 386062.15 377957 397129 28480515 28480515 0.00
crit 18.56 20.10% 772094.10 735963 819242 772156.67 741786 806430 14328298 14328298 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 33547 1.7% 10.3 30.48sec 652809 467438 Direct 10.3 114198 228338 137218 20.2%  
Periodic 108.2 40970 81979 49202 20.1% 68.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.32 10.32 108.19 108.19 1.3966 1.9108 6739525.27 6739525.27 0.00 30476.42 467438.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.24 79.83% 114197.91 109031 121369 114207.41 109981 120420 941180 941180 0.00
crit 2.08 20.17% 228337.57 218063 242739 204859.09 0 242739 475439 475439 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.5 79.93% 40970.33 19 45513 40974.51 39352 42924 3542668 3542668 0.00
crit 21.7 20.07% 81979.04 39 91027 81983.54 68273 88892 1780238 1780238 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 182862 / 24383
Lightning Blast 182862 1.9% 38.6 6.75sec 189566 190387 Direct 38.6 157819 315651 189562 20.1%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.59 38.59 0.00 0.00 0.9957 0.0000 7314461.30 7314461.30 0.00 190386.56 190386.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.82 79.89% 157818.81 151433 168568 157815.89 153167 165039 4864603 4864603 0.00
crit 7.76 20.11% 315650.51 302865 337137 315605.41 0 337137 2449858 2449858 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Sentinel
Ascendance 2.0 186.11sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Sentinel
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 97.96sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 1.0770 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Sentinel
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Sentinel
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.64sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8593 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.93sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5089 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 6.0 0.0 48.8sec 48.8sec 28.06% 48.09% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:28.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.3sec 25.0sec 32.23% 32.23% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.2sec 69.2sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.7 51.3 4.4sec 2.5sec 66.88% 70.84% 51.3(58.7) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.37%
  • elemental_focus_2:38.51%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.3 0.8 13.5sec 13.0sec 8.09% 23.67% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.09%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 30.01% 30.01% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.5sec 69.5sec 13.52% 13.52% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.52%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 84.3sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.3 34.3sec 18.9sec 38.22% 33.66% 6.3(17.5) 0.7

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.17%
  • power_of_the_maelstrom_2:6.10%
  • power_of_the_maelstrom_3:25.94%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 10.08% 10.94% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.11%
  • stormkeeper_2:3.00%
  • stormkeeper_3:3.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.49% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Sentinel
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.1 13.0sec
Lava Surge: Wasted 0.8 83.8sec
Lava Surge: During Lava Burst 7.8 34.2sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6330.0007.9592.1780.00010.196
Fire Elemental0.4030.0011.7370.5880.0004.061
Ascendance6.1130.00175.5706.0050.00075.570
Lava Burst0.7950.00011.1535.2860.00021.231

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Sentinel
earth_shock Maelstrom 52.6 5317.8 101.0 101.0 16119.6
flame_shock Maelstrom 11.3 207.5 18.3 18.3 181386.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.27 1162.54 (20.83%) 11.71 28.70 2.41%
Lava Burst Overload Maelstrom 59.40 507.64 (9.09%) 8.55 26.99 5.05%
Lightning Bolt Maelstrom 75.53 604.21 (10.82%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 77.69 462.91 (8.29%) 5.96 3.22 0.69%
Aftershock Maelstrom 63.96 1657.61 (29.69%) 25.92 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.54 (5.20%) 0.97 8.04 2.69%
The Deceiver's Blood Pact Maelstrom 10.53 896.76 (16.06%) 85.16 167.00 15.70%
Resource RPS-Gain RPS-Loss
Maelstrom 18.61 18.42
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.51 10.60 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Sentinel Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Whispers + Sentinel Damage Per Second
Count 24999
Mean 1288309.46
Minimum 1056022.57
Maximum 1645171.61
Spread ( max - min ) 589149.04
Range [ ( max - min ) / 2 * 100% ] 22.87%
Standard Deviation 75013.6156
5th Percentile 1169283.76
95th Percentile 1415387.21
( 95th Percentile - 5th Percentile ) 246103.45
Mean Distribution
Standard Deviation 474.4373
95.00% Confidence Intervall ( 1287379.58 - 1289239.34 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 131
0.1% Error 13024
0.1 Scale Factor Error with Delta=300 48035672
0.05 Scale Factor Error with Delta=300 192142687
0.01 Scale Factor Error with Delta=300 4803567151
Priority Target DPS
Sample Data Whispers + Sentinel Priority Target Damage Per Second
Count 24999
Mean 1288309.46
Minimum 1056022.57
Maximum 1645171.61
Spread ( max - min ) 589149.04
Range [ ( max - min ) / 2 * 100% ] 22.87%
Standard Deviation 75013.6156
5th Percentile 1169283.76
95th Percentile 1415387.21
( 95th Percentile - 5th Percentile ) 246103.45
Mean Distribution
Standard Deviation 474.4373
95.00% Confidence Intervall ( 1287379.58 - 1289239.34 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 131
0.1% Error 13024
0.1 Scale Factor Error with Delta=300 48035672
0.05 Scale Factor Error with Delta=300 192142687
0.01 Scale Factor Error with Delta=300 4803567151
DPS(e)
Sample Data Whispers + Sentinel Damage Per Second (Effective)
Count 24999
Mean 1288309.46
Minimum 1056022.57
Maximum 1645171.61
Spread ( max - min ) 589149.04
Range [ ( max - min ) / 2 * 100% ] 22.87%
Damage
Sample Data Whispers + Sentinel Damage
Count 24999
Mean 329627393.99
Minimum 264549009.71
Maximum 427827934.77
Spread ( max - min ) 163278925.06
Range [ ( max - min ) / 2 * 100% ] 24.77%
DTPS
Sample Data Whispers + Sentinel Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Sentinel Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Sentinel Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Sentinel Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Sentinel Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Sentinel Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + SentinelTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Sentinel Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.43 totem_mastery,if=buff.resonance_totem.remains<2
9 3.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 3.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.54 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 21.06 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.43 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 99.57 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.71 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 31.57 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.57 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.82 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 50.64 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHLQQQFLLLIILLLLLLILLLLNQQQNLIILLLLILLLLLGLIILLLLNPPNPLJNQQQQLLIMLLLLLL97ILLLLLLILMQQNNLLLLLILLOQNNQQLLANJQQMLLNILLLLIILLLLLLILLPNILPMPLNQQQQNQLQNNQLLNHLLL9JLKKIKLFLLLILLLLLILLLLLIMPPPLNIQOQQLLNQLNQLLQMQNALLPJKKNLQQNQQLQNQQQLNMNIILLNQQQQNL9LQNNLLLLLLIIIL

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Sentinel 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.110 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.965 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:02.743 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.3/125: 11% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:03.498 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:04.252 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.031 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.3/125: 28% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:05.786 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom bloodlust, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:06.539 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:07.292 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:07.292 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.085 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.3/125: 69% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:08.877 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:09.633 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.3/125: 96% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:10.390 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.143 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.921 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:12.697 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.5/125: 51% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:13.451 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:14.764 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 89.5/125: 72% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:16.076 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:17.390 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:18.375 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:19.715 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:21.055 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, potion_of_prolonged_power
0:22.395 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:23.535 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:24.390 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.2/125: 27% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:25.528 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.2/125: 35% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:26.670 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.2/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:27.810 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:28.647 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.1/125: 77% maelstrom bloodlust, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:29.485 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.1/125: 94% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:30.323 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:31.162 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:32.279 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:33.396 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:34.236 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:35.374 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:36.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, ascendance, lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:37.086 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:38.227 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:39.367 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.6/125: 68% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:40.509 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.6/125: 78% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:41.647 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.6/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.759 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.6/125: 85% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.239 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.6/125: 96% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:45.329 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:46.419 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:47.871 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:49.322 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
0:50.774 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.254 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.364 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.843 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.323 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.436 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.917 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.397 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:01.510 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.7/125: 60% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.623 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.736 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.9/125: 26% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.848 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:05.960 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.9/125: 50% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:07.442 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.9/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.922 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 91.9/125: 74% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.030 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.9/125: 99% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.143 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.254 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.8/125: 21% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:13.735 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.848 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.8/125: 41% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.329 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.8/125: 53% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:17.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:19.233 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.8/125: 89% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:20.685 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:21.773 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.773 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:22.886 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.367 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.849 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.329 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:28.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:29.869 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:31.319 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:32.410 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:33.862 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:34.975 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.455 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.936 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.048 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.1/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.158 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.7/125: 25% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:41.607 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:42.697 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:44.149 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:45.599 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.7/125: 82% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.080 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.192 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.674 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.155 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:51.909 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:53.389 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:54.499 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:55.612 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:57.093 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:58.573 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:00.024 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.113 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.113 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.201 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:03.291 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.379 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.470 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 61.1/125: 49% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.583 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.1/125: 38% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.695 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.1/125: 56% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.174 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.1/125: 67% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:10.265 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.3/125: 95% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:11.354 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:12.443 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:13.896 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:15.346 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:16.459 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.0/125: 94% maelstrom ascendance, elemental_focus(2), stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:17.571 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:18.683 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.166 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.645 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.126 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:24.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 101.5/125: 81% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:25.719 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:27.201 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:28.291 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:29.741 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.191 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.645 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.736 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.4/125: 97% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:34.845 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.7/125: 30% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:35.616 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:36.647 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:37.420 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:38.450 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:39.481 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.7/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:40.256 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:41.285 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:42.314 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:43.344 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/125: 52% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:44.375 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:45.149 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:46.177 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:47.917 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:49.658 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:50.962 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.4/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:52.267 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:54.008 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.8/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.489 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.599 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.8/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.709 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/125: 24% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.821 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 17.0/125: 14% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.302 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.0/125: 25% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.0/125: 42% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.261 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:04.371 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 86.0/125: 69% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:05.483 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.0/125: 70% maelstrom ascendance, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:06.964 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/125: 80% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:08.075 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/125: 92% maelstrom elemental_focus(2), stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.187 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:09.961 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:10.736 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 58.5/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:11.766 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:11.766 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:12.795 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
3:13.825 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 106.5/125: 85% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:14.854 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:15.628 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:16.657 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:17.431 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:18.205 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:19.235 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 108.5/125: 87% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:20.008 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:20.781 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
3:22.523 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:24.229 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
3:25.934 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:27.641 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:29.347 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:30.459 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.572 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.052 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.533 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.012 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.495 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:38.606 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:39.718 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.198 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.952 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.5/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.433 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.912 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.025 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.505 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.616 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.096 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.207 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.319 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.0/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.800 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.0/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.281 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.0/125: 37% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.394 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.0/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:57.875 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:58.987 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:00.467 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.0/125: 57% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.579 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.579 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.692 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:04.172 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.653 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.766 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom elemental_focus, stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.877 single_asc K lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.3/125: 79% maelstrom stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.967 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 113.3/125: 91% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:10.057 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:11.509 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.597 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.2/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:14.047 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.2/125: 59% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.161 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.1/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.642 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.1/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.124 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.1/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.603 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.084 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.195 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.9/125: 22% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.676 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.158 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:26.637 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.9/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:28.117 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.9/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:29.228 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:30.339 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.1/125: 76% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:31.451 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.6/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:32.563 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:33.674 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:34.784 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:36.235 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:37.325 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:38.334 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:39.344 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.7/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:40.355 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.7/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:41.383 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:42.157 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:43.188 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:43.962 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.7/125: 43% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:44.737 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:45.768 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.7/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:46.543 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.2/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:47.318 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.9/125: 25% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:48.346 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:49.374 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.9/125: 46% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:51.115 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.9/125: 56% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:52.419 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.9/125: 74% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:54.158 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.9/125: 85% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:55.899 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:57.205 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.317 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.429 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60314 58083 47992 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60314 58083 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 59.94% 59.94% 7455
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Tarnished Sentinel Medallion
ilevel: 930, stats: { +1320 Mastery }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Sentinel"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=tarnished_sentinel_medallion,id=147017,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=47992
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=7455
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Terror : 1288384 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1288384.4 1288384.4 942.8 / 0.073% 296755.7 / 23.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Terror 1288384
Earth Shock 290908 22.6% 51.4 5.67sec 1696346 1651342 Direct 51.4 1180031 3388876 1696366 23.4%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.45 51.45 0.00 0.00 1.0273 0.0000 87271782.47 87271782.47 0.00 1651342.17 1651342.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.42 76.62% 1180031.38 735320 1607822 1179708.86 994214 1377944 46518144 46518144 0.00
crit 12.03 23.38% 3388876.42 2111840 4617666 3387755.58 2417171 4343130 40753639 40753639 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 127282 9.9% 11.3 27.12sec 3369146 3309821 Direct 11.3 89325 260526 218140 75.2%  
Periodic 221.0 49244 196523 161633 76.3% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.95 220.95 1.0179 1.3494 38185404.44 38185404.44 0.00 123300.83 3309820.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.81 24.76% 89325.27 79958 97906 88596.35 0 97906 250682 250682 0.00
crit 8.53 75.24% 260526.11 229640 281187 260581.97 246763 272110 2221635 2221635 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.3 23.69% 49244.32 84 53849 49254.63 46209 51352 2577725 2577725 0.00
crit 168.6 76.31% 196522.82 194 216518 196527.90 186685 203297 33135362 33135362 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 314769 (460303) 24.4% (35.7%) 99.3 3.00sec 1391240 1100443 Direct 99.1 0 953342 953342 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.26 99.05 0.00 0.00 1.2643 0.0000 94429437.26 94429437.26 0.00 1100443.04 1100443.04
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 99.05 100.00% 953342.14 757085 1159669 951671.71 883365 1021782 94429437 94429437 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 131488 10.2% 52.1 5.66sec 757758 0 Direct 51.9 0 759760 759760 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.06 51.92 0.00 0.00 0.0000 0.0000 39445735.88 39445735.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.92 100.00% 759760.19 603355 924191 758446.62 691697 823658 39445736 39445736 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14046 1.1% 73.8 3.81sec 57087 0 Direct 73.8 45936 93713 57086 23.3%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.82 73.82 0.00 0.00 0.0000 0.0000 4213922.03 4213922.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.59 76.66% 45936.11 44113 49104 45935.29 44455 47669 2599477 2599477 0.00
crit 17.23 23.34% 93713.43 89990 100172 93711.66 89990 98717 1614445 1614445 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 89407 (163340) 6.9% (12.7%) 76.4 3.84sec 641248 491952 Direct 76.4 243993 702252 350998 23.4%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.42 76.42 0.00 0.00 1.3035 0.0000 26821681.52 26821681.52 0.00 491951.58 491951.58
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.57 76.65% 243992.69 158476 582148 245240.05 201272 338837 14291303 14291303 0.00
crit 17.84 23.35% 702251.97 455142 1671928 705297.77 482006 1333126 12530379 12530379 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 73934 5.7% 72.8 5.12sec 304773 0 Direct 72.8 211724 609085 304764 23.4%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.77 72.77 0.00 0.00 0.0000 0.0000 22179647.88 22179647.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 55.73 76.58% 211724.21 133120 489004 212420.79 153504 299310 11799725 11799725 0.00
crit 17.04 23.42% 609084.58 382320 1404419 610994.58 404784 1149483 10379923 10379923 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Terror From Below 49453 3.8% 9.7 29.07sec 1536432 0 Direct 9.7 1233906 2517168 1536574 23.6%  

Stats details: terror_from_below

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.66 9.66 0.00 0.00 0.0000 0.0000 14835210.10 14835210.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.38 76.43% 1233905.72 1233906 1233906 1233856.36 0 1233906 9105404 9105404 0.00
crit 2.28 23.57% 2517167.67 2517168 2517168 2285780.36 0 2517168 5729806 5729806 0.00
 
 

Action details: terror_from_below

Static Values
  • id:242524
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:242524
  • name:Terror From Below
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a behemoth from the deep to swallow your target whole, dealing {$s1=303078} Nature damage split amongst you and all nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:973452.41
  • base_dd_max:973452.41
 
pet - primal_fire_elemental 252855 / 172039
Fire Blast 218495 11.5% 93.7 3.16sec 475906 240539 Direct 93.7 385896 771825 475903 23.3%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.72 93.72 0.00 0.00 1.9785 0.0000 44602422.06 44602422.06 0.00 240538.98 240538.98
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 71.86 76.68% 385896.39 367981 409621 385928.92 377239 397140 27731410 27731410 0.00
crit 21.86 23.32% 771824.95 735963 819242 771895.48 746445 803761 16871012 16871012 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34360 1.8% 10.5 30.15sec 669846 479519 Direct 10.5 114162 228343 140909 23.4%  
Periodic 109.6 40962 81945 50524 23.3% 69.8%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.47 10.47 109.57 109.57 1.3970 1.9120 7010567.83 7010567.83 0.00 31280.84 479519.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.01 76.58% 114161.69 109031 121369 114169.74 109031 120420 914944 914944 0.00
crit 2.45 23.42% 228343.23 218063 242739 214738.42 0 242739 559779 559779 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.0 76.67% 40961.86 19 45513 40965.42 39174 42816 3440912 3440912 0.00
crit 25.6 23.33% 81945.25 63 91027 81950.00 67797 89070 2094932 2094932 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 187935 / 25060
Lightning Blast 187935 1.9% 38.6 6.73sec 194860 195674 Direct 38.6 157823 315738 194861 23.5%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.58 38.58 0.00 0.00 0.9959 0.0000 7517408.86 7517408.86 0.00 195674.13 195674.13
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.53 76.55% 157823.16 151433 168568 157821.02 153141 165250 4660527 4660527 0.00
crit 9.05 23.45% 315738.39 302865 337137 315708.82 0 337137 2856882 2856882 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Terror
Ascendance 2.0 185.64sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Terror
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 96.71sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.97 0.00 0.00 0.00 1.0770 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Terror
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Terror
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.61sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8591 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.71sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.2sec 49.2sec 27.64% 47.86% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.1sec 25.0sec 32.24% 32.24% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 69.4sec 69.4sec 8.70% 8.70% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 68.4 54.1 4.4sec 2.4sec 68.81% 72.37% 54.1(62.3) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.69%
  • elemental_focus_2:40.12%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.4 0.8 13.5sec 13.0sec 8.11% 23.76% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.11%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.92% 29.92% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.7sec 69.7sec 13.51% 13.51% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.4 34.2sec 18.9sec 38.03% 33.38% 6.4(17.6) 0.6

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.15%
  • power_of_the_maelstrom_2:6.13%
  • power_of_the_maelstrom_3:25.75%

Trigger Attempt Success

  • trigger_pct:15.05%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 10.03% 10.79% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.09%
  • stormkeeper_2:2.99%
  • stormkeeper_3:3.95%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.61% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Terror
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.1 13.0sec
Lava Surge: Wasted 0.8 85.3sec
Lava Surge: During Lava Burst 7.8 34.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6320.0008.0232.1760.0009.770
Fire Elemental0.4230.0011.7390.6400.0004.246
Ascendance6.0600.00186.0275.9490.00086.027
Lava Burst0.8000.00010.2555.3180.00020.619

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Terror
earth_shock Maelstrom 51.4 5175.3 100.6 100.6 16863.3
flame_shock Maelstrom 11.3 207.7 18.3 18.3 183874.3
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.26 1164.25 (21.41%) 11.73 26.82 2.25%
Lava Burst Overload Maelstrom 52.06 445.56 (8.19%) 8.56 22.95 4.90%
Lightning Bolt Maelstrom 76.42 611.33 (11.24%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 72.77 433.79 (7.98%) 5.96 2.85 0.65%
Aftershock Maelstrom 62.78 1614.88 (29.69%) 25.72 0.00 0.00%
Resonance Totem Maelstrom 298.57 290.93 (5.35%) 0.97 7.64 2.56%
The Deceiver's Blood Pact Maelstrom 10.32 878.11 (16.15%) 85.05 160.58 15.46%
Resource RPS-Gain RPS-Loss
Maelstrom 18.13 17.94
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 56.45 10.60 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Terror Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Whispers + Terror Damage Per Second
Count 24999
Mean 1288384.44
Minimum 1031342.10
Maximum 1602533.82
Spread ( max - min ) 571191.73
Range [ ( max - min ) / 2 * 100% ] 22.17%
Standard Deviation 76052.7505
5th Percentile 1166833.70
95th Percentile 1416966.14
( 95th Percentile - 5th Percentile ) 250132.44
Mean Distribution
Standard Deviation 481.0094
95.00% Confidence Intervall ( 1287441.67 - 1289327.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 134
0.1% Error 13386
0.1 Scale Factor Error with Delta=300 49375729
0.05 Scale Factor Error with Delta=300 197502915
0.01 Scale Factor Error with Delta=300 4937572875
Priority Target DPS
Sample Data Whispers + Terror Priority Target Damage Per Second
Count 24999
Mean 1288384.44
Minimum 1031342.10
Maximum 1602533.82
Spread ( max - min ) 571191.73
Range [ ( max - min ) / 2 * 100% ] 22.17%
Standard Deviation 76052.7505
5th Percentile 1166833.70
95th Percentile 1416966.14
( 95th Percentile - 5th Percentile ) 250132.44
Mean Distribution
Standard Deviation 481.0094
95.00% Confidence Intervall ( 1287441.67 - 1289327.20 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 134
0.1% Error 13386
0.1 Scale Factor Error with Delta=300 49375729
0.05 Scale Factor Error with Delta=300 197502915
0.01 Scale Factor Error with Delta=300 4937572875
DPS(e)
Sample Data Whispers + Terror Damage Per Second (Effective)
Count 24999
Mean 1288384.44
Minimum 1031342.10
Maximum 1602533.82
Spread ( max - min ) 571191.73
Range [ ( max - min ) / 2 * 100% ] 22.17%
Damage
Sample Data Whispers + Terror Damage
Count 24999
Mean 327382821.59
Minimum 258317641.20
Maximum 407927186.55
Spread ( max - min ) 149609545.35
Range [ ( max - min ) / 2 * 100% ] 22.85%
DTPS
Sample Data Whispers + Terror Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Terror Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Terror Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Terror Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Terror Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Terror Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + TerrorTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Terror Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.97 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 20.12 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.36 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 99.55 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.79 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 31.32 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.99 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 51.44 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGPPPEKKKKKHKKKKKHKKKKKHKKKKKKHKKKLMOOOKMHHKKPKMHHHKPMPPIKLKMPPKPMMKKKKKHHK97KOMOOPKMLPPKPMPPPKMNPKPPKKMIPLPPKKMKKKKKKHKKKMMOOOKHKKKKKKHHKKKFKKKHKKKMOO9GKKMKIJJJKHKKEKKKHKKKKHKKKKKLMOOOKMPKNPKMPPPPKMPLPPKPIMPPKPMKPKMKKPPMMKKKMLP9PPPKMPPPKMPPPKKMOOOKM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Terror 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.968 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:02.758 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 13.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:03.552 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 26.3/125: 21% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:04.307 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.3/125: 18% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:05.061 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom bloodlust, elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:05.817 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.3/125: 31% maelstrom bloodlust, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:06.571 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:06.571 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:07.363 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.3/125: 54% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
0:08.156 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.3/125: 64% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:08.933 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.3/125: 74% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:09.710 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.3/125: 84% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:10.489 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:11.243 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:12.019 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:12.797 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:13.573 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.7/125: 74% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:14.886 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.7/125: 85% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:15.892 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:16.879 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:18.193 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:19.507 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:20.819 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:22.132 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.5/125: 88% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.272 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.127 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.266 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.4/125: 41% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.405 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.4/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.546 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.4/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:28.663 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.4/125: 80% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:29.781 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.4/125: 90% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:30.899 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:31.737 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:32.854 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:33.973 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.112 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.967 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.5/125: 73% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.822 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.961 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom bloodlust, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.101 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.241 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.098 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.8/125: 82% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.210 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.322 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.433 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:45.545 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.024 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:48.504 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.615 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.728 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.839 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:52.951 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.063 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:55.543 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.023 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.5/125: 57% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:58.133 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.614 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.8/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:01.066 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:02.155 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:03.605 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.693 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.8/125: 49% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:05.783 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.8/125: 59% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:06.893 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.7/125: 19% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:08.003 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:09.115 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:10.594 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.707 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.7/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.820 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:13.931 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:15.411 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.7/125: 38% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:16.892 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:18.372 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.7/125: 67% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:19.854 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.7/125: 77% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.335 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.7/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.447 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:23.559 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:25.010 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.099 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:26.099 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:27.552 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:29.003 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:30.091 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:31.543 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:32.995 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.3/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:34.447 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.3/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
1:35.899 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.3/125: 81% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:37.013 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 41.6/125: 33% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.124 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:39.603 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.6/125: 30% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:41.082 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.6/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:42.562 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.6/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.043 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.6/125: 68% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.154 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.1/125: 26% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:46.636 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.1/125: 34% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.118 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.1/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.598 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.080 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.1/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.191 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 27.2/125: 22% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.946 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.2/125: 22% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.428 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.518 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.2/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.970 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.421 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.2/125: 55% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.511 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.2/125: 71% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:00.960 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 101.2/125: 81% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.070 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.262 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.374 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 42.5/125: 34% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.488 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.5/125: 24% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:06.261 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:07.034 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:08.060 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:08.833 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:09.607 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 27.6/125: 22% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:10.637 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:11.668 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:12.698 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.6/125: 68% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:13.727 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 97.6/125: 78% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:14.756 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.6/125: 88% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:15.788 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.6/125: 99% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:16.562 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, potion_of_prolonged_power
2:17.591 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:19.298 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:21.003 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:22.287 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 115.6/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
2:23.568 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
2:25.307 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.1/125: 37% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.786 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.1/125: 54% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.266 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.1/125: 66% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:29.379 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.1/125: 94% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:30.491 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:31.973 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:33.452 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.2/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:34.482 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 85.2/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:35.510 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.2/125: 79% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:36.540 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.2/125: 89% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:37.568 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:38.342 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:39.114 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
2:39.887 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:40.916 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.5/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:41.944 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:42.718 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.5/125: 72% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:43.746 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
2:44.779 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:46.520 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:47.828 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:49.567 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:51.307 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
2:52.615 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.5/125: 71% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.727 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.9/125: 22% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:55.208 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.9/125: 30% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.688 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.798 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 59.9/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.909 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.9/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.390 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:01.502 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.9/125: 66% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.615 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 26.5/125: 21% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.098 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.186 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.5/125: 40% maelstrom ascendance, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:06.275 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom ascendance, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:07.364 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom ascendance, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:08.455 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:09.905 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:11.020 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.502 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.952 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:13.952 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:15.402 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:16.854 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:18.306 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:19.415 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.528 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.008 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:23.119 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.4/125: 84% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:24.598 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.4/125: 95% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:25.709 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.8/125: 29% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:27.187 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.8/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.669 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.151 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:31.261 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 90.8/125: 73% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:32.743 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.8/125: 83% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:33.856 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.8/125: 80% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:34.966 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.5/125: 25% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:36.444 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.5/125: 33% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:37.924 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 56.5/125: 45% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:39.375 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:40.826 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:41.917 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:43.366 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:44.456 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:45.210 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:46.662 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.6/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:48.141 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 91.6/125: 73% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.253 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.9/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:50.733 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:52.212 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.9/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:53.692 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:55.173 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:56.653 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 86.9/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.764 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.7/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.244 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.356 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.7/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:01.837 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.7/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.318 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.799 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.278 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.390 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.7/125: 68% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.502 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.9/125: 22% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:09.613 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:10.725 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.9/125: 42% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:12.205 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.9/125: 52% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:13.315 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.9/125: 71% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:14.428 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.541 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.3/125: 34% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:17.021 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.3/125: 41% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:18.132 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.3/125: 59% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:19.243 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 23.2/125: 19% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:20.354 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:21.835 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.2/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:23.286 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:24.295 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:25.054 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.3/125: 86% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:25.811 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.4/125: 27% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:26.572 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 55.4/125: 44% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:27.583 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:28.342 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.4/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:29.115 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 28.1/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:29.887 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 15.1/125: 12% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:30.916 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:31.690 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.1/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:32.721 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:33.751 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:34.780 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:36.520 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.1/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:37.824 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.5/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:39.565 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:41.305 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
4:43.046 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:44.530 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:45.641 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.4/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.121 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:48.602 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:50.081 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:51.561 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.672 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 114.4/125: 92% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.783 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:55.264 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.6/125: 36% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.745 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.6/125: 53% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:58.226 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:59.705 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 107.6/125: 86% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60314 58083 47992 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60314 58083 0
Crit 22.59% 22.59% 7038
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Terror From Below
ilevel: 930, stats: { +1320 Crit }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Terror"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=terror_from_below,id=147016,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=47992
# gear_crit_rating=7038
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Thurible : 1264010 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1264010.3 1264010.3 935.6 / 0.074% 293758.4 / 23.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 50.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Thurible 1264010
Earth Shock 285056 22.6% 51.4 5.65sec 1663752 1619776 Direct 51.4 1209096 3471689 1663714 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.40 51.40 0.00 0.00 1.0272 0.0000 85516072.49 85516072.49 0.00 1619775.97 1619775.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.07 79.91% 1209095.58 754685 1650164 1208741.18 1012164 1417202 49658365 49658365 0.00
crit 10.33 20.09% 3471688.61 2167455 4739271 3469334.76 2304727 4479856 35857707 35857707 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 128743 10.2% 11.3 27.10sec 3408773 3348966 Direct 11.3 91583 267444 220970 73.6%  
Periodic 221.0 50507 202216 163466 74.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.97 220.97 1.0179 1.3493 38623622.68 38623622.68 0.00 124717.45 3348965.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.99 26.42% 91582.64 82064 100485 91119.80 0 98520 274195 274195 0.00
crit 8.34 73.58% 267444.01 235687 288592 267505.95 252728 279604 2229609 2229609 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.4 25.54% 50507.50 549 55268 50518.68 46740 52582 2850899 2850899 0.00
crit 164.5 74.46% 202216.22 145 222220 202226.47 191250 210145 33268919 33268919 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 317440 (464116) 25.1% (36.7%) 99.1 3.02sec 1404419 1111014 Direct 98.9 0 962610 962610 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.14 98.93 0.00 0.00 1.2641 0.0000 95230354.74 95230354.74 0.00 1111014.24 1111014.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.93 100.00% 962610.00 777023 1158811 961027.60 896305 1029869 95230355 95230355 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 132669 10.5% 52.0 5.69sec 765194 0 Direct 51.9 0 767191 767191 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.01 51.88 0.00 0.00 0.0000 0.0000 39800058.54 39800058.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.88 100.00% 767190.73 619244 923507 765947.84 693314 825905 39800059 39800059 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14007 1.1% 73.7 3.78sec 56978 0 Direct 73.7 47149 96176 56978 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.75 73.75 0.00 0.00 0.0000 0.0000 4201890.77 4201890.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.96 79.95% 47148.64 45274 50397 47148.36 45614 49088 2779894 2779894 0.00
crit 14.79 20.05% 96176.38 92360 102810 96171.52 92360 102810 1421997 1421997 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 87807 (160225) 6.9% (12.7%) 76.6 3.82sec 627336 481320 Direct 76.6 249752 719911 343790 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.62 76.62 0.00 0.00 1.3034 0.0000 26341611.07 26341611.07 0.00 481319.90 481319.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 61.29 80.00% 249751.58 162649 597478 251048.57 205020 341457 15307930 15307930 0.00
crit 15.33 20.00% 719910.51 467128 1715957 723283.00 485813 1667653 11033681 11033681 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 72418 5.7% 72.8 5.10sec 298307 0 Direct 72.8 216708 623978 298315 20.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.83 72.83 0.00 0.00 0.0000 0.0000 21724919.39 21724919.39 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.24 79.96% 216708.14 136625 501882 217453.57 159542 315005 12619459 12619459 0.00
crit 14.59 20.04% 623978.25 392388 1441404 626142.53 409028 1273965 9105460 9105460 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Piercing Anguish 31432 2.5% 16.2 18.44sec 583014 0 Direct 16.0 487076 993635 588478 20.0%  

Stats details: piercing_anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.17 16.02 0.00 0.00 0.0000 0.0000 9429503.31 9429503.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.82 79.98% 487076.02 487076 487076 487076.02 487076 487076 6241953 6241953 0.00
crit 3.21 20.02% 993635.07 993635 993635 958617.97 0 993635 3187550 3187550 0.00
 
 

Action details: piercing_anguish

Static Values
  • id:246751
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:246751
  • name:Piercing Anguish
  • school:shadow
  • tooltip:
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:389379.80
  • base_dd_max:389379.80
 
pet - primal_fire_elemental 253000 / 169394
Fire Blast 218573 11.6% 92.3 3.21sec 475834 240671 Direct 92.3 396207 792405 475825 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.27 92.27 0.00 0.00 1.9771 0.0000 43906785.83 43906785.83 0.00 240670.85 240670.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.73 79.90% 396206.53 377672 420408 396243.37 387221 407394 29211694 29211694 0.00
crit 18.54 20.10% 792405.49 755344 840817 792478.11 764310 828607 14695092 14695092 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 34427 1.8% 10.3 30.60sec 669936 479653 Direct 10.3 117200 234455 140707 20.0%  
Periodic 108.1 42051 84106 50500 20.1% 68.9%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.32 10.32 108.13 108.13 1.3968 1.9109 6912278.87 6912278.87 0.00 31272.89 479652.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.25 79.95% 117199.66 111903 124565 117207.51 112877 123754 966828 966828 0.00
crit 2.07 20.05% 234454.81 223806 249131 211343.77 0 249131 484937 484937 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.4 79.91% 42050.82 20 46712 42054.36 40327 44145 3633237 3633237 0.00
crit 21.7 20.09% 84106.06 40 93424 84113.12 65736 91281 1827276 1827276 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 187833 / 25046
Lightning Blast 187833 2.0% 38.6 6.73sec 194689 195567 Direct 38.6 161971 324010 194690 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.59 38.59 0.00 0.00 0.9955 0.0000 7513301.72 7513301.72 0.00 195567.23 195567.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.80 79.81% 161971.26 155421 173008 161968.93 157224 169499 4988584 4988584 0.00
crit 7.79 20.19% 324009.67 310841 346015 324023.56 310841 346015 2524718 2524718 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Thurible
Ascendance 2.0 186.15sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Thurible
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 98.17sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.95 0.00 0.00 0.00 1.0774 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Thurible
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Thurible
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.60sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8588 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.52sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.2sec 49.2sec 27.58% 47.74% 0.0(0.0) 5.8

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.1 35.2sec 25.0sec 32.21% 32.21% 3.1(3.1) 8.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.5 0.0 69.2sec 69.2sec 8.71% 8.71% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.4 51.5 4.5sec 2.5sec 66.90% 70.70% 51.5(58.9) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.39%
  • elemental_focus_2:38.51%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.4 0.8 13.5sec 13.0sec 8.11% 23.81% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.11%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.2 23.1sec 17.1sec 29.94% 29.94% 4.2(4.2) 12.6

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.5 0.0 69.6sec 69.6sec 13.53% 13.53% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 84.2sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.3 34.2sec 18.9sec 37.89% 33.25% 6.3(17.4) 0.6

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.13%
  • power_of_the_maelstrom_2:6.13%
  • power_of_the_maelstrom_3:25.63%

Trigger Attempt Success

  • trigger_pct:15.01%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Spear of Anguish 16.2 0.0 18.3sec 18.3sec 16.10% 16.10% 0.0(0.0) 16.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_spear_of_anguish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • spear_of_anguish_1:16.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243644
  • name:Spear of Anguish
  • tooltip:Readying a Spear of Anguish that will inflict {$246751s1=121231} Shadow damage to all enemies it passes through.
  • description:{$@spelldesc242605=Your ranged attacks and spells have a chance to conjure a Spear of Anguish. After {$242606d=3 seconds} the spear launches towards its target, dealing {$246751s1=121231} Shadow damage to all enemies it passes through.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 9.99% 10.78% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.08%
  • stormkeeper_2:2.98%
  • stormkeeper_3:3.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.56% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Thurible
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.2 13.0sec
Lava Surge: Wasted 0.8 82.4sec
Lava Surge: During Lava Burst 7.8 34.0sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6300.0006.7922.1630.0009.600
Fire Elemental0.4030.0011.7400.5870.0003.900
Ascendance6.0230.00174.5035.9140.00074.503
Lava Burst0.7930.0009.5635.2820.00022.605

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Thurible
earth_shock Maelstrom 51.4 5167.6 100.5 100.5 16548.6
flame_shock Maelstrom 11.3 207.6 18.3 18.3 186039.5
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.14 1163.33 (21.42%) 11.73 26.39 2.22%
Lava Burst Overload Maelstrom 52.02 445.38 (8.20%) 8.56 22.76 4.86%
Lightning Bolt Maelstrom 76.61 612.92 (11.28%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 72.82 434.10 (7.99%) 5.96 2.85 0.65%
Aftershock Maelstrom 62.73 1612.55 (29.69%) 25.71 0.00 0.00%
Resonance Totem Maelstrom 298.58 291.03 (5.36%) 0.97 7.55 2.53%
The Deceiver's Blood Pact Maelstrom 10.25 872.03 (16.06%) 85.05 158.56 15.39%
Resource RPS-Gain RPS-Loss
Maelstrom 18.10 17.92
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.89 11.30 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Thurible Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Whispers + Thurible Damage Per Second
Count 24999
Mean 1264010.30
Minimum 996610.97
Maximum 1584075.75
Spread ( max - min ) 587464.78
Range [ ( max - min ) / 2 * 100% ] 23.24%
Standard Deviation 75474.2195
5th Percentile 1143790.85
95th Percentile 1392504.52
( 95th Percentile - 5th Percentile ) 248713.68
Mean Distribution
Standard Deviation 477.3504
95.00% Confidence Intervall ( 1263074.71 - 1264945.89 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 137
0.1% Error 13696
0.1 Scale Factor Error with Delta=300 48627387
0.05 Scale Factor Error with Delta=300 194509547
0.01 Scale Factor Error with Delta=300 4862738662
Priority Target DPS
Sample Data Whispers + Thurible Priority Target Damage Per Second
Count 24999
Mean 1264010.30
Minimum 996610.97
Maximum 1584075.75
Spread ( max - min ) 587464.78
Range [ ( max - min ) / 2 * 100% ] 23.24%
Standard Deviation 75474.2195
5th Percentile 1143790.85
95th Percentile 1392504.52
( 95th Percentile - 5th Percentile ) 248713.68
Mean Distribution
Standard Deviation 477.3504
95.00% Confidence Intervall ( 1263074.71 - 1264945.89 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 137
0.1% Error 13696
0.1 Scale Factor Error with Delta=300 48627387
0.05 Scale Factor Error with Delta=300 194509547
0.01 Scale Factor Error with Delta=300 4862738662
DPS(e)
Sample Data Whispers + Thurible Damage Per Second (Effective)
Count 24999
Mean 1264010.30
Minimum 996610.97
Maximum 1584075.75
Spread ( max - min ) 587464.78
Range [ ( max - min ) / 2 * 100% ] 23.24%
Damage
Sample Data Whispers + Thurible Damage
Count 24999
Mean 320868033.00
Minimum 246699352.13
Maximum 410405618.02
Spread ( max - min ) 163706265.89
Range [ ( max - min ) / 2 * 100% ] 25.51%
DTPS
Sample Data Whispers + Thurible Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Thurible Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Thurible Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Thurible Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Thurible Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Thurible Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + ThuribleTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Thurible Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.95 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.47 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 20.02 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.33 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 99.44 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.79 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 31.38 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.97 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 51.67 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGJJJEKKKHKKKKHKKKKKHKKKKMOOMKHKKKKKHKKLMKKKKKKHHHKKOMKIJJKHKKKKHFKJKMKK97KKKHKKMOOPLKMPPPPKMONOOKMKKKIJHJJKKLMHHPKPMMPPKMPPPPKMLPPPKMMPPPKMHPPKMMGPPIKJJJKEHKKK9KHKKKKKHKOLOMOKPPMPKKMKNOOKMHOPPMKKLPPMIKPPKMPPPKKMPPPKMPPPPKMLPPKPMPKPKKMKKKK9KHK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Thurible 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.111 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.967 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:03.105 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, potion_of_prolonged_power
0:04.246 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.102 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:05.956 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:06.810 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom bloodlust, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.667 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:07.667 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:08.807 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.3/125: 74% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:09.947 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.3/125: 91% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.087 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:11.942 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.080 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:14.197 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:14.952 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.5/125: 90% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:15.730 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:16.483 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:17.236 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw, potion_of_prolonged_power
0:18.015 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:18.792 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:19.569 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
0:20.362 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
0:21.116 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:21.909 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:22.664 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, potion_of_prolonged_power
0:23.458 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.5/125: 76% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
0:24.250 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
0:25.004 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom bloodlust, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
0:25.797 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.3/125: 43% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, spear_of_anguish, potion_of_prolonged_power
0:26.590 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom bloodlust, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:27.596 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:28.937 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:29.923 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:31.238 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.1/125: 42% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:32.554 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw, potion_of_prolonged_power
0:33.869 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.1/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, potion_of_prolonged_power
0:35.210 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.1/125: 88% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:36.348 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.1/125: 98% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:37.203 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:38.341 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/125: 48% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.478 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.0/125: 66% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.335 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.0/125: 62% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.189 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.4/125: 20% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.669 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.4/125: 30% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:44.121 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:45.573 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:47.024 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.4/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:48.476 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.4/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:49.926 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.4/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:51.016 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
0:52.105 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
0:53.216 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:54.697 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.178 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:57.659 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.772 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
0:59.885 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.111 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:02.223 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
1:03.333 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.4/125: 84% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.814 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.4/125: 94% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.925 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.5/125: 36% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:07.406 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:08.856 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.5/125: 65% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:10.307 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:11.398 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:12.489 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:13.579 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom ascendance, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:15.059 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom elemental_focus, stormkeeper, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:16.173 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
1:17.654 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.766 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.247 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:21.728 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.839 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:22.839 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:24.320 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.4/125: 67% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:25.801 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.4/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:27.281 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:28.390 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:29.870 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:31.350 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:32.460 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:33.940 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.7/125: 33% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:35.420 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.7/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.901 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.7/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.014 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.7/125: 53% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:39.495 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.608 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.4/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.089 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:43.571 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.4/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.051 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, potion_of_prolonged_power
1:46.533 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.4/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:47.986 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.4/125: 76% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw, potion_of_prolonged_power
1:49.076 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:50.528 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:51.281 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:52.735 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.6/125: 44% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:54.186 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.6/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:55.638 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.6/125: 77% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:56.727 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.4/125: 24% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:58.178 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:59.629 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.4/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.109 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.220 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom ascendance, lava_surge, elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.330 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.4/125: 96% maelstrom ascendance, lava_surge, elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:04.442 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom ascendance, lava_surge, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:05.554 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom ascendance, lava_surge, stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:06.666 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.1/125: 59% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.778 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.1/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.259 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.1/125: 87% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:10.371 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.1/125: 77% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.483 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.593 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.704 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:15.184 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:16.663 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:18.144 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:19.256 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:20.368 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:21.849 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.3/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:23.329 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.3/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:24.809 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:25.919 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.1/125: 19% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:27.397 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.1/125: 26% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:28.875 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.1/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:30.355 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:31.834 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.1/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:33.311 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.1/125: 74% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish
2:34.422 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.0/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:35.533 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.0/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.013 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:38.466 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/125: 40% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:39.918 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.0/125: 53% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:41.369 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.0/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:42.459 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.7/125: 90% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:43.571 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:45.050 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:46.529 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.3/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:48.010 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:49.490 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.3/125: 71% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:50.604 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:51.716 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.196 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.678 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.5/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.158 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:57.270 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:58.382 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 31.3/125: 25% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
2:59.492 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 18.3/125: 15% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:00.973 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.3/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:02.454 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:03.567 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:04.677 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.3/125: 47% maelstrom elemental_focus(2), stormkeeper(3), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.789 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 79.3/125: 63% maelstrom elemental_focus, stormkeeper(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.901 single_asc J lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 100.3/125: 80% maelstrom stormkeeper, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.010 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.3/125: 92% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.491 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.491 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.603 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.086 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.566 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:15.046 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:16.157 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 107.5/125: 86% maelstrom ascendance, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:17.269 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 120.5/125: 96% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:18.358 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:19.810 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:21.262 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:22.714 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
3:24.164 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:25.645 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:26.757 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:28.238 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:29.718 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.828 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.307 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.4/125: 63% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:33.419 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:34.900 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish
3:36.381 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.8/125: 43% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:37.862 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.8/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:39.343 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.8/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:40.454 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.2/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:41.935 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:43.045 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:44.526 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:45.636 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/125: 20% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:46.748 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.503 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.0/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:48.983 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.0/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.464 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.946 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.0/125: 78% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.059 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:54.170 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:55.200 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:56.229 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.5/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:57.259 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:58.034 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:58.807 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 52.6/125: 42% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:59.837 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 65.6/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
4:00.611 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.6/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:01.620 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:02.629 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:03.388 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:04.320 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom lava_surge, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:05.077 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.1/125: 42% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
4:05.837 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.1/125: 54% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:07.117 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.1/125: 66% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, mark_of_the_claw
4:08.823 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.1/125: 78% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:10.131 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.2/125: 31% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:11.437 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.2/125: 39% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due, spear_of_anguish
4:13.177 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.2/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:14.916 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.398 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.2/125: 70% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.511 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 109.2/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:18.624 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.9/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.103 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.9/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:21.583 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.9/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.063 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.9/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.544 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.9/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:25.655 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.2/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.106 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, spear_of_anguish, mark_of_the_claw
4:28.558 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.2/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, spear_of_anguish, mark_of_the_claw
4:30.010 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.2/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:31.461 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.2/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:32.942 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 90.2/125: 72% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:34.053 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:35.163 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.2/125: 19% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:36.645 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.2/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:38.125 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:39.577 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.2/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.028 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.2/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.118 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.6/125: 24% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.570 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.6/125: 32% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:44.659 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:46.110 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 68.6/125: 55% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:47.561 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 81.6/125: 65% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.672 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.6/125: 83% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.783 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.5/125: 27% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.263 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.742 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:54.195 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:55.285 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:56.374 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:57.824 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 119.5/125: 96% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:58.914 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.2/125: 30% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 60314 58083 47992 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 60314 58083 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 8.30% 8.30% 3944
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 937.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Spectral Thurible
ilevel: 930, stats: { +1320 Vers }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Thurible"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=spectral_thurible,id=147018,ilevel=930
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=937.38
# gear_stamina=46429
# gear_intellect=47992
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=3944
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Whispers + Tome : 1296036 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1296036.4 1296036.4 962.0 / 0.074% 299693.3 / 23.1% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 51.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Whispers + Tome 1296036
Earth Shock 298471 23.0% 51.4 5.68sec 1742806 1696954 Direct 51.4 1236072 3571167 1742882 21.7%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.38 51.38 0.00 0.00 1.0270 0.0000 89539759.20 89539759.20 0.00 1696953.65 1696953.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.23 78.30% 1236072.18 773651 1683114 1235598.66 1044016 1453092 49722121 49722121 0.00
crit 11.15 21.70% 3571167.49 2221925 4833903 3570639.69 2535114 4737614 39817638 39817638 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 132742 10.2% 11.3 27.12sec 3514469 3452105 Direct 11.3 93796 273529 226785 74.0%  
Periodic 221.0 51730 206483 168606 75.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 220.96 220.96 1.0181 1.3494 39823484.04 39823484.04 0.00 128590.61 3452105.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.95 26.01% 93795.86 84126 102491 93351.55 0 102491 276462 276462 0.00
crit 8.38 73.99% 273529.49 241610 294354 273590.75 261673 285106 2293212 2293212 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.1 24.48% 51730.36 821 56371 51742.18 47997 53872 2797747 2797747 0.00
crit 166.9 75.52% 206482.66 126 226657 206490.72 196007 213634 34456063 34456063 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Insidious Corruption 15479 1.2% 5.1 60.37sec 902926 0 Periodic 48.8 78686 160633 95162 20.1% 20.0%

Stats details: insidious_corruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.14 0.00 48.80 48.80 0.0000 1.2305 4643500.66 4643500.66 0.00 77334.97 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.0 79.89% 78685.55 82 84196 78672.31 73324 84196 3067544 3067544 0.00
crit 9.8 20.11% 160632.69 168 171760 160596.81 0 171760 1575956 1575956 0.00
 
 

Action details: insidious_corruption

Static Values
  • id:243941
  • school:shadow
  • resource:none
  • range:50.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:243941
  • name:Insidious Corruption
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every ${$t1}.1 sec.
  • description:Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:69081.05
  • dot_duration:12.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 329051 (481088) 25.4% (37.1%) 99.1 2.99sec 1456058 1151780 Direct 98.9 0 998041 998041 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.12 98.91 0.00 0.00 1.2642 0.0000 98713523.41 98713523.41 0.00 1151780.16 1151780.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 98.91 100.00% 998041.02 796550 1256746 996453.82 918487 1064437 98713523 98713523 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 137470 10.6% 52.0 5.64sec 793342 0 Direct 51.8 0 795477 795477 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.98 51.84 0.00 0.00 0.0000 0.0000 41240128.73 41240128.73 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 51.84 100.00% 795477.04 634806 1001556 794214.15 726463 861682 41240129 41240129 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 14567 1.1% 73.7 3.78sec 59286 0 Direct 73.7 48234 98421 59286 22.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.71 73.71 0.00 0.00 0.0000 0.0000 4370160.89 4370160.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.48 77.98% 48234.26 46412 51403 48234.05 46787 50100 2772537 2772537 0.00
crit 16.23 22.02% 98421.11 94680 104862 98421.33 94680 104862 1597624 1597624 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 90960 (165843) 7.0% (12.8%) 76.6 3.85sec 649415 498077 Direct 76.6 256452 728455 356188 21.1%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.61 76.61 0.00 0.00 1.3038 0.0000 27287448.85 27287448.85 0.00 498077.01 498077.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.42 78.87% 256451.81 166737 609408 257762.10 211226 341455 15494554 15494554 0.00
crit 16.19 21.13% 728455.06 478867 1750220 731745.06 498745 1335970 11792894 11792894 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 74883 5.8% 72.8 5.12sec 308671 0 Direct 72.8 222499 632181 308657 21.0%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.78 72.78 0.00 0.00 0.0000 0.0000 22464467.03 22464467.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 57.47 78.97% 222498.55 140059 511903 223265.15 165464 326907 12786554 12786554 0.00
crit 15.31 21.03% 632180.90 402249 1470185 634435.15 421666 1201283 9677913 9677913 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 261639 / 176799
Fire Blast 226033 11.8% 93.1 3.18sec 492233 248861 Direct 93.1 405107 810368 492246 21.5%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.10 93.10 0.00 0.00 1.9779 0.0000 45825811.19 45825811.19 0.00 248861.27 248861.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.08 78.50% 405106.57 387163 428803 405139.38 396943 415121 29606062 29606062 0.00
crit 20.02 21.50% 810367.70 774326 857606 810467.35 785003 845376 16219749 16219749 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 35606 1.9% 10.4 30.27sec 693574 496518 Direct 10.4 119843 239836 146203 22.0%  
Periodic 108.9 43018 85967 52264 21.5% 69.4%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.40 10.40 108.94 108.94 1.3969 1.9117 7214899.39 7214899.39 0.00 32382.42 496517.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 8.12 78.02% 119843.19 114715 127053 119852.20 115506 126262 972691 972691 0.00
crit 2.29 21.98% 239836.17 229430 254106 221067.50 0 254106 548281 548281 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 85.5 78.47% 43017.71 22 47645 43021.30 41184 45014 3677400 3677400 0.00
crit 23.5 21.53% 85966.54 41 95290 85972.95 71364 92680 2016528 2016528 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 192095 / 25614
Lightning Blast 192095 2.0% 38.6 6.75sec 199194 199995 Direct 38.6 165697 331381 199197 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 38.57 38.57 0.00 0.00 0.9960 0.0000 7683813.74 7683813.74 0.00 199995.15 199995.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 30.78 79.78% 165697.11 159326 176462 165696.95 161209 173018 5099404 5099404 0.00
crit 7.80 20.22% 331380.77 318653 352924 331304.47 0 352924 2584410 2584410 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Whispers + Tome
Ascendance 2.0 185.93sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Tome
  • harmful:false
  • if_expr:
 
Fire Elemental 4.0 97.17sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.96 0.00 0.00 0.00 1.0772 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Tome
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Whispers + Tome
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.61sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8591 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.72sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5088 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.9 0.0 49.3sec 49.3sec 27.58% 47.79% 0.0(0.0) 5.7

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:27.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.1sec 32.17% 32.17% 3.0(3.0) 8.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Devil's Due 3.4 0.0 68.8sec 68.8sec 8.69% 8.69% 0.0(0.0) 3.2

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_devils_due
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.18

Stack Uptimes

  • devils_due_1:8.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225776
  • name:Devil's Due
  • tooltip:Cast speed slowed by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 67.7 52.5 4.4sec 2.5sec 67.53% 71.25% 52.5(60.2) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.45%
  • elemental_focus_2:39.08%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Extracted Sanity 5.1 0.0 60.0sec 60.0sec 20.00% 20.00% 0.0(0.0) 5.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_extracted_sanity
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:3082.72

Stack Uptimes

  • extracted_sanity_1:20.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:243942
  • name:Extracted Sanity
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc243941=Deal $o1 Shadow damage over {$d=12 seconds}. When this effect ends or the target dies, you gain {$243942s1=1910} Critical Strike for {$243942d=12 seconds} plus any time remaining on the effect.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 21.3 0.8 13.5sec 13.0sec 8.08% 23.73% 0.8(0.8) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:8.08%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.1sec 17.1sec 30.02% 30.02% 4.3(4.3) 12.6

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:30.02%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Nefarious Pact 3.4 0.0 69.2sec 69.2sec 13.51% 13.51% 0.0(0.0) 3.3

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_nefarious_pact
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.44

Stack Uptimes

  • nefarious_pact_1:13.51%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225774
  • name:Nefarious Pact
  • tooltip:Cast speed increased by {$s1=0}%.
  • description:{$@spelldesc225142=Your damaging spells have a chance to grant Nefarious Pact, increasing your casting speed by {$225774s1=0}% for {$225774d=12 seconds}. When Nefarious Pact expires, your casting speed is decreased by {$225776s1=0}% for {$225776d=8 seconds}.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.5sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.6 6.3 34.3sec 19.0sec 37.81% 33.20% 6.3(17.4) 0.6

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.13%
  • power_of_the_maelstrom_2:6.09%
  • power_of_the_maelstrom_3:25.59%

Trigger Attempt Success

  • trigger_pct:14.99%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.7sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.6sec 61.6sec 9.98% 10.77% 0.0(0.0) 0.2

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.07%
  • stormkeeper_2:2.98%
  • stormkeeper_3:3.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.7sec 100.00% 96.19% 2.0(2.0) 0.0

Buff details

  • buff initial source:Whispers + Tome
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 22.1 13.0sec
Lava Surge: Wasted 0.8 82.1sec
Lava Surge: During Lava Burst 7.8 34.1sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6270.0008.1862.1560.0009.838
Fire Elemental0.4180.0011.7380.6220.0003.904
Ascendance5.9770.00174.6235.8720.00074.623
Lava Burst0.7950.00011.7085.2900.00025.042

Resources

Resource Usage Type Count Total Average RPE APR
Whispers + Tome
earth_shock Maelstrom 51.4 5166.0 100.6 100.6 17332.5
flame_shock Maelstrom 11.3 207.6 18.3 18.3 191806.4
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 99.13 1163.00 (21.42%) 11.73 26.51 2.23%
Lava Burst Overload Maelstrom 51.99 444.96 (8.19%) 8.56 22.92 4.90%
Lightning Bolt Maelstrom 76.60 612.82 (11.29%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 72.77 433.74 (7.99%) 5.96 2.91 0.67%
Aftershock Maelstrom 62.71 1612.09 (29.69%) 25.71 0.00 0.00%
Resonance Totem Maelstrom 298.57 291.00 (5.36%) 0.97 7.57 2.54%
The Deceiver's Blood Pact Maelstrom 10.25 872.06 (16.06%) 85.06 159.19 15.44%
Resource RPS-Gain RPS-Loss
Maelstrom 18.10 17.91
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 55.42 10.40 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Whispers + Tome Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Whispers + Tome Damage Per Second
Count 24999
Mean 1296036.40
Minimum 1044264.50
Maximum 1635920.62
Spread ( max - min ) 591656.13
Range [ ( max - min ) / 2 * 100% ] 22.83%
Standard Deviation 77602.6513
5th Percentile 1172866.65
95th Percentile 1427747.03
( 95th Percentile - 5th Percentile ) 254880.38
Mean Distribution
Standard Deviation 490.8121
95.00% Confidence Intervall ( 1295074.43 - 1296998.37 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13773
0.1 Scale Factor Error with Delta=300 51408720
0.05 Scale Factor Error with Delta=300 205634879
0.01 Scale Factor Error with Delta=300 5140871955
Priority Target DPS
Sample Data Whispers + Tome Priority Target Damage Per Second
Count 24999
Mean 1296036.40
Minimum 1044264.50
Maximum 1635920.62
Spread ( max - min ) 591656.13
Range [ ( max - min ) / 2 * 100% ] 22.83%
Standard Deviation 77602.6513
5th Percentile 1172866.65
95th Percentile 1427747.03
( 95th Percentile - 5th Percentile ) 254880.38
Mean Distribution
Standard Deviation 490.8121
95.00% Confidence Intervall ( 1295074.43 - 1296998.37 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 138
0.1% Error 13773
0.1 Scale Factor Error with Delta=300 51408720
0.05 Scale Factor Error with Delta=300 205634879
0.01 Scale Factor Error with Delta=300 5140871955
DPS(e)
Sample Data Whispers + Tome Damage Per Second (Effective)
Count 24999
Mean 1296036.40
Minimum 1044264.50
Maximum 1635920.62
Spread ( max - min ) 591656.13
Range [ ( max - min ) / 2 * 100% ] 22.83%
Damage
Sample Data Whispers + Tome Damage
Count 24999
Mean 328082472.82
Minimum 258351558.67
Maximum 422404835.83
Spread ( max - min ) 164053277.16
Range [ ( max - min ) / 2 * 100% ] 25.00%
DTPS
Sample Data Whispers + Tome Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Whispers + Tome Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Whispers + Tome Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Whispers + Tome Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Whispers + Tome Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Whispers + Tome Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Whispers + TomeTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Whispers + Tome Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.41 totem_mastery,if=buff.resonance_totem.remains<2
9 3.96 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
A 5.14 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
B 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
C 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
D 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
E 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
F 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
G 2.48 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
H 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
I 20.02 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
J 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
K 6.34 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
L 99.42 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
M 6.78 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
N 31.35 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
O 1.59 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
P 18.93 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
Q 51.70 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569AGLLHQQQFLLLLILLLLLILLLLLILPNLLLLLILLLLLMNIILLLLLLILLNPPPAJLNMQQLLLNQQQ97NLLQLNQQQQLLIQQLQMNQQLQNQQQLNOQQQLNIAQJQLNMQQQQLNPLNPLPNPQLLNPPPNLLLMNQQLLNQQQQL9HLNAQQJLNNQQQLFLLILLLLLILLLLLIPMPPNQLQNLLLLLI8LLNPPMPALNQJLNQLQQQNLQLNPLPLLILL9LLLLIIMLLPNILLLLLILLNPM

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask Whispers + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food Whispers + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation Whispers + Tome 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.112 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.970 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:03.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:04.206 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.045 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:05.884 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.3/125: 32% maelstrom bloodlust, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:06.722 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom bloodlust, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:07.561 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.561 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.3/125: 51% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.700 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 77.3/125: 62% maelstrom bloodlust, ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.555 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.696 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 112.3/125: 90% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.837 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.693 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.834 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:14.973 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:16.114 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:17.254 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:18.108 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:18.948 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.1/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:20.065 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:21.183 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.1/125: 51% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:22.300 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:23.418 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.1/125: 79% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
0:24.536 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.1/125: 97% maelstrom bloodlust, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
0:25.391 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom bloodlust, lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.246 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.4/125: 55% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.383 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.4/125: 62% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.238 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.5/125: 24% maelstrom bloodlust, ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.376 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.5/125: 35% maelstrom bloodlust, ascendance, lava_surge, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.232 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 65.5/125: 52% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.372 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 78.5/125: 63% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.511 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.366 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.5/125: 98% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:34.221 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.1/125: 30% maelstrom bloodlust, ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.359 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 51.1/125: 41% maelstrom bloodlust, ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.499 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.1/125: 58% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.355 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.1/125: 69% maelstrom bloodlust, ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:38.497 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.1/125: 79% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:39.637 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.1/125: 90% maelstrom bloodlust, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:40.493 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.1/125: 86% maelstrom bloodlust, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:41.348 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:42.460 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:43.571 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.683 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.164 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.5/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.644 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:48.756 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 100.5/125: 80% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:50.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 114.5/125: 92% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:51.718 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:52.832 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom lava_surge, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:53.945 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:55.425 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.5/125: 67% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:56.536 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:58.016 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.4/125: 36% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
0:59.497 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.976 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:00.976 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
1:02.089 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.4/125: 76% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:03.568 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.4/125: 87% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:04.678 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 33.8/125: 27% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:05.789 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.8/125: 17% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:06.900 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.8/125: 24% maelstrom lava_surge, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
1:08.011 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom lava_surge, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:09.123 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.8/125: 49% maelstrom lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:10.233 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.8/125: 60% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:11.714 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.8/125: 70% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
1:12.825 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.9/125: 30% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
1:13.600 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity
1:14.630 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.9/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity
1:15.659 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 63.9/125: 51% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity
1:16.433 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity
1:16.433 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.9/125: 57% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:17.207 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:18.237 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:19.010 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:20.041 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.9/125: 54% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:20.814 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 87.9/125: 70% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:21.587 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:22.617 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:23.646 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, extracted_sanity, potion_of_prolonged_power
1:24.677 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.0/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, extracted_sanity, mark_of_the_claw, potion_of_prolonged_power
1:25.685 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.0/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
1:27.391 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.0/125: 77% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
1:28.672 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.0/125: 94% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
1:29.954 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.4/125: 29% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
1:31.661 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.4/125: 37% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw, potion_of_prolonged_power
1:33.368 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 56.4/125: 45% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
1:34.821 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.4/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:36.301 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.4/125: 71% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:37.413 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 81.4/125: 65% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:38.526 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:40.007 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.7/125: 29% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:41.487 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.7/125: 41% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:42.967 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.7/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:44.448 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.559 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.4/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:47.040 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.4/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.521 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.003 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:51.483 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.4/125: 64% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.595 single_asc O totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.350 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.1/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:54.829 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.1/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.309 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:57.789 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.1/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.270 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 88.1/125: 70% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.382 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 124.5/125: 100% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:01.495 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:01.495 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:02.947 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 48.7/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:04.036 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:05.124 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.7/125: 52% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:06.574 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.7/125: 62% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:07.686 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 34.8/125: 28% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:08.799 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 21.8/125: 17% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:09.910 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.8/125: 25% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:11.022 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.8/125: 37% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:12.503 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 54.8/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:13.984 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 70.8/125: 57% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:15.464 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 83.8/125: 67% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity, potion_of_prolonged_power
2:16.575 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:18.055 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:19.167 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.7/125: 57% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:20.278 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.7/125: 18% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:21.758 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.7/125: 26% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:23.239 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.7/125: 46% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:24.721 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
2:25.831 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.5/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:27.310 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.5/125: 36% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:28.792 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:29.882 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:31.334 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:32.424 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:33.875 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 48.4/125: 39% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:35.326 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.4/125: 51% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:36.806 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.4/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:37.917 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.9/125: 31% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:39.028 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:40.138 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.9/125: 66% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:41.620 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.9/125: 78% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:42.710 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 92.9/125: 74% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:43.800 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.5/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:45.250 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:46.701 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:47.792 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
2:49.242 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:50.353 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.5/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:51.832 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.5/125: 36% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:53.311 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:54.791 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.5/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
2:56.271 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.383 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 97.5/125: 78% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.494 single_asc H flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:59.603 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.054 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 99.5/125: 80% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.143 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 31.2/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.143 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.2/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.595 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.2/125: 33% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:05.046 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 56.2/125: 45% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
3:06.158 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.2/125: 46% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.637 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.2/125: 57% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.749 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.5/125: 75% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:09.861 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 29.4/125: 24% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:10.973 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.4/125: 36% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:12.086 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 53.4/125: 43% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:13.199 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.4/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:14.680 single_asc F ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:14.680 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
3:16.161 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.4/125: 79% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:17.642 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.4/125: 97% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:18.753 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.7/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:20.234 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:21.716 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:23.198 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.7/125: 69% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
3:24.678 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.7/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, extracted_sanity
3:25.707 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 122.7/125: 98% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, extracted_sanity
3:26.481 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:27.510 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.3/125: 40% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact
3:28.537 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 72.3/125: 58% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:29.548 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:30.558 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 116.3/125: 93% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:31.569 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:32.327 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:33.336 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:34.094 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, nefarious_pact, mark_of_the_claw
3:35.105 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.5/125: 44% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:36.115 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
3:36.873 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
3:38.577 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:40.317 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:42.058 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.3/125: 67% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:43.364 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due
3:44.670 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:46.149 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.5/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:47.630 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.5/125: 66% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:49.110 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 104.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:50.590 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:51.701 default 8 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:52.455 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:53.935 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:55.416 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 84.5/125: 68% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:56.527 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 26.7/125: 21% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.007 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.486 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 51.7/125: 41% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:00.597 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:02.080 default A use_items Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.080 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:03.560 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 73.7/125: 59% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.670 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.6/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:06.152 single_asc J stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 42.6/125: 34% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:07.267 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom lava_surge, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:08.379 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.467 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.9/125: 18% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:10.556 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:12.008 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.9/125: 37% maelstrom stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:13.097 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.9/125: 49% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.187 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 69.9/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:15.667 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.9/125: 63% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:16.778 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.3/125: 26% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:17.889 single_asc Q lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.3/125: 36% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:19.371 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.3/125: 43% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:20.852 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:21.964 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.5/125: 19% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, extracted_sanity
4:23.445 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 32.5/125: 26% maelstrom lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:24.558 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, extracted_sanity
4:26.038 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, extracted_sanity
4:27.066 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 86.5/125: 69% maelstrom lava_surge, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact
4:27.840 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:28.599 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 35.6/125: 28% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:29.608 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.6/125: 39% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:30.617 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:31.375 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 62.6/125: 50% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:32.385 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.6/125: 60% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:33.392 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 88.6/125: 71% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:34.401 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.6/125: 88% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:35.159 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:35.919 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:36.677 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, nefarious_pact, mark_of_the_claw
4:37.437 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 24.5/125: 20% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
4:39.143 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
4:40.850 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, devils_due, mark_of_the_claw
4:42.556 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:43.862 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.2/125: 94% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, devils_due
4:45.168 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:46.648 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.3/125: 39% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:48.129 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 63.3/125: 51% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:49.610 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.3/125: 61% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:51.092 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 99.3/125: 79% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:52.572 single_asc I earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 121.3/125: 97% maelstrom ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:53.683 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.6/125: 37% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:55.163 single_asc L lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.6/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:56.644 single_asc N earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.756 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.2/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.236 single_asc M flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 45.2/125: 36% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 63458 61227 50986 (25388)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 63458 61227 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 938.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Trinket1 Whispers in the Dark
ilevel: 910, stats: { +2264 Int }
Local Trinket2 Tome of Unraveling Sanity
ilevel: 940, stats: { +2994 AgiInt }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="Whispers + Tome"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
trinket1=whispers_in_the_dark,id=140809,ilevel=910
trinket2=tome_of_unraveling_sanity,id=147019,ilevel=940
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=938.00
# gear_stamina=46429
# gear_intellect=50986
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

baseline : 1102063 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
1102063.2 1102063.2 770.8 / 0.070% 241732.2 / 21.9% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.00% 48.4 100.0% 100%
Talents
  • 15: Totem Mastery (Elemental Shaman)
  • 30: Gust of Wind
  • 45: Lightning Surge Totem
  • 60: Aftershock (Elemental Shaman)
  • 75: Primal Elementalist (Elemental Shaman)
  • 90: Echo of the Elements
  • 100: Ascendance (Elemental Shaman)
  • Talent Calculator
Artifact

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
baseline 1102063
Earth Shock 257394 23.4% 49.2 5.90sec 1568014 1466303 Direct 49.2 1139724 3274682 1568050 20.1%  

Stats details: earth_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.25 49.25 0.00 0.00 1.0694 0.0000 77216994.44 77216994.44 0.00 1466303.23 1466303.23
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.37 79.94% 1139723.64 706341 1550899 1139287.72 963600 1324802 44866603 44866603 0.00
crit 9.88 20.06% 3274682.01 2028612 4454181 3271815.47 2295539 4219477 32350391 32350391 0.00
 
 

Action details: earth_shock

Static Values
  • id:8042
  • school:nature
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:115.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
Spelldata
  • id:8042
  • name:Earth Shock
  • school:nature
  • tooltip:
  • description:Instantly shocks the target with concussive force, causing up to {$s1=0} Nature damage based on Maelstrom spent.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:11.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Flame Shock 113884 10.3% 11.3 27.13sec 3016852 2892963 Direct 11.3 85779 251081 204599 71.9%  
Periodic 211.8 47287 189395 150356 72.5% 99.4%

Stats details: flame_shock

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.33 11.33 211.82 211.82 1.0429 1.4075 34165891.42 34165891.42 0.00 110230.69 2892962.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.18 28.12% 85779.26 76807 94440 85559.63 0 92526 273152 273152 0.00
crit 8.14 71.88% 251080.51 220590 271232 251139.15 238115 262625 2043952 2043952 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.2 27.47% 47287.05 1515 51943 47295.07 44186 49255 2751697 2751697 0.00
crit 153.6 72.53% 189395.08 270 208853 189422.08 181433 196694 29097090 29097090 0.00
 
 

Action details: flame_shock

Static Values
  • id:188389
  • school:fire
  • resource:maelstrom
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:20.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.chain_lightning<4&maelstrom>=20
Spelldata
  • id:188389
  • name:Flame Shock
  • school:fire
  • tooltip:Suffering $w2 Fire damage every $t2 sec.
  • description:Sears the target with fire, causing {$s1=1} Fire damage and then an additional $o2 Fire damage over {$d=15 seconds}.$?a232643[ Maelstrom increases duration up to {$s3=100}%.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.400000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Lava Burst 284619 (416093) 25.8% (37.8%) 95.1 3.17sec 1311994 996085 Direct 94.9 0 899294 899294 100.0%  

Stats details: lava_burst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.14 94.95 0.00 0.00 1.3172 0.0000 85384006.80 85384006.80 0.00 996084.65 996084.65
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 94.95 100.00% 899294.18 727248 1089103 897937.12 832037 958845 85384007 85384007 0.00
 
 

Action details: lava_burst

Static Values
  • id:51505
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:40.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:8.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
Spelldata
  • id:51505
  • name:Lava Burst
  • school:fire
  • tooltip:
  • description:Hurls molten lava at the target, dealing {$s1=1} Fire damage.$?a231721[ Lava Burst will always critically strike if the target is affected by Flame Shock.][]{$?s137039=false}[][ |cFFFFFFFFGenerates {$s2=12} Maelstrom.|r ]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lava Burst Overload 118869 10.8% 49.9 5.99sec 714884 0 Direct 49.7 0 716795 716795 100.0%  

Stats details: lava_burst_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.88 49.75 0.00 0.00 0.0000 0.0000 35660055.82 35660055.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 49.75 100.00% 716795.39 579577 867954 715686.54 653031 781831 35660056 35660056 0.00
 
 

Action details: lava_burst_overload

Static Values
  • id:77451
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:32.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:77451
  • name:Lava Burst Overload
  • school:fire
  • tooltip:
  • description:You hurl molten lava at the target, dealing {$s1=1} Fire damage. If your Flame Shock is on the target, Lava Burst will deal a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Volcanic Inferno 12604 1.1% 70.8 4.05sec 53406 0 Direct 70.8 44203 90181 53405 20.0%  

Stats details: volcanic_inferno

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.80 70.80 0.00 0.00 0.0000 0.0000 3781281.85 3781281.85 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.63 79.98% 44202.84 42374 47365 44202.56 42704 45951 2503261 2503261 0.00
crit 14.17 20.02% 90181.27 86444 96625 90179.73 86444 96625 1278021 1278021 0.00
 
 

Action details: volcanic_inferno

Static Values
  • id:205533
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205533
  • name:Volcanic Inferno
  • school:fire
  • tooltip:
  • description:{$@spelldesc192630=Lava Burst has a chance to open a volcanic fissure under your target, dealing ${6*{$205533s1=5}} Fire damage over {$205532d=6 seconds} to all enemies within $205533A1 yds of the target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:5.00
  • base_dd_max:5.00
 
Lightning Bolt 79445 (145520) 7.2% (13.2%) 73.0 3.96sec 598283 438278 Direct 73.0 237411 682975 326643 20.0%  

Stats details: lightning_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.97 72.97 0.00 0.00 1.3651 0.0000 23833105.21 23833105.21 0.00 438277.77 438277.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.36 79.98% 237410.80 152230 561537 238571.95 192984 329686 13854301 13854301 0.00
crit 14.61 20.02% 682975.34 437205 1612735 686067.55 457045 1309674 9978804 9978804 0.00
 
 

Action details: lightning_bolt

Static Values
  • id:188196
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
Spelldata
  • id:188196
  • name:Lightning Bolt
  • school:nature
  • tooltip:
  • description:Hurls a bolt of lightning at the target, dealing {$s1=1} Nature damage.$?a187828[ |cFFFFFFFFGenerates {$214815s1=8} Maelstrom.|r ][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Lightning Bolt Overload 66076 6.0% 70.1 5.25sec 282838 0 Direct 70.1 205370 591532 282820 20.1%  

Stats details: lightning_bolt_overload

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 70.08 70.08 0.00 0.00 0.0000 0.0000 19821990.36 19821990.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.03 79.94% 205369.72 127873 471691 206006.65 147153 294087 11505981 11505981 0.00
crit 14.06 20.06% 591531.54 367252 1354697 593559.29 367252 1299788 8316010 8316010 0.00
 
 

Action details: lightning_bolt_overload

Static Values
  • id:45284
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:45284
  • name:Lightning Bolt Overload
  • school:nature
  • tooltip:
  • description:Casts a bolt of lightning at the target for {$s1=1} Nature damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
pet - primal_fire_elemental 227679 / 146661
Fire Blast 196310 11.5% 85.0 3.42sec 446436 216400 Direct 85.0 371856 743813 446432 20.1%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 84.98 84.98 0.00 0.00 2.0630 0.0000 37938170.42 37938170.42 0.00 216400.03 216400.03
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.94 79.95% 371855.53 353479 395119 371879.02 363800 383358 25264006 25264006 0.00
crit 17.04 20.05% 743812.78 706958 790238 743855.15 716567 781696 12674164 12674164 0.00
 
 

Action details: fire_blast

Static Values
  • id:57984
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57984
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Inflicts Fire damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.700000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Immolate 31369 1.8% 10.0 31.47sec 607780 423803 Direct 10.0 109969 220033 132179 20.2%  
Periodic 100.0 39505 79029 47426 20.0% 66.6%

Stats details: immolate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.97 9.97 100.00 100.00 1.4341 1.9981 6060807.43 6060807.43 0.00 28306.05 423803.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.96 79.82% 109969.26 104735 117072 109975.94 105525 116123 875335 875335 0.00
crit 2.01 20.18% 220033.08 209469 234145 196374.04 0 234145 442753 442753 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.0 79.96% 39504.66 13597 43902 39505.71 38310 41026 3158870 3158870 0.00
crit 20.0 20.04% 79029.12 14575 87804 79032.87 66581 85505 1583849 1583849 0.00
 
 

Action details: immolate

Static Values
  • id:118297
  • school:fire
  • resource:mana
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:1.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:118297
  • name:Immolate
  • school:fire
  • tooltip:Fire damage inflicted every $t1 sec.
  • description:Burns an enemy, then inflicts additional Fire damage every $t1 sec. for {$d=21 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:0.00
  • base_dd_max:0.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.300000
  • base_td:0.00
  • dot_duration:21.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - greater_lightning_elemental 168822 / 22511
Lightning Blast 168822 2.0% 37.0 7.04sec 182511 174674 Direct 37.0 151827 303708 182512 20.2%  

Stats details: lightning_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.00 37.00 0.00 0.00 1.0449 0.0000 6752888.89 6752888.89 0.00 174673.79 174673.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.53 79.80% 151827.11 145465 162600 151826.78 147310 159085 4482719 4482719 0.00
crit 7.47 20.20% 303708.40 290929 325201 303642.07 0 325201 2270170 2270170 0.00
 
 

Action details: lightning_blast

Static Values
  • id:191726
  • school:nature
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.4
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191726
  • name:Lightning Blast
  • school:nature
  • tooltip:
  • description:Inflicts Nature damage to an enemy.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
baseline
Ascendance 2.0 186.00sec

Stats details: ascendance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: ascendance

Static Values
  • id:114050
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:114050
  • name:Ascendance
  • school:physical
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
Fire Elemental 3.9 102.89sec

Stats details: fire_elemental

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.86 0.00 0.00 0.00 1.1063 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: fire_elemental

Static Values
  • id:198067
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:300.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:198067
  • name:Fire Elemental
  • school:fire
  • tooltip:
  • description:Calls forth a Greater Fire Elemental to rain destruction on your enemies for {$188592d=60 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:baseline
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Stormkeeper 5.0 61.66sec

Stats details: stormkeeper

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 0.00 0.00 0.8838 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: stormkeeper

Static Values
  • id:205495
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:205495
  • name:Stormkeeper
  • school:nature
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
 
Totem Mastery 3.0 113.53sec

Stats details: totem_mastery

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.00 0.00 0.00 0.00 0.5030 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: totem_mastery

Static Values
  • id:210643
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:210643
  • name:Totem Mastery
  • school:nature
  • tooltip:
  • description:Summons four totems that increase your combat capabilities for {$202188d=120 seconds}. |cFFFFFFFFResonance Totem|r Generates {$202192s1=1} Maelstrom every $202192t1 sec. |cFFFFFFFFStorm Totem|r Increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$210651s2=10}%. |cFFFFFFFFEmber Totem|r Increases Flame Shock damage over time by {$210658s1=10}%. |cFFFFFFFFTailwind Totem|r Increases your haste by {$210659s1=2}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ascendance 5.8 0.0 50.1sec 50.1sec 26.91% 46.20% 0.0(0.0) 5.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ascendance
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • ascendance_1:26.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:114050
  • name:Ascendance
  • tooltip:Transformed into a powerful Fire ascendant. Chain Lightning is transformed into Lava Beam.
  • description:Transform into a Flame Ascendant for {$d=15 seconds}, replacing Chain Lightning with Lava Beam, removing the cooldown on Lava Burst, and increasing the damage of Lava Burst by an amount equal to your critical strike chance.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.33% 13.33% 0.0(0.0) 1.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Concordance of the Legionfall 8.3 3.0 35.2sec 25.0sec 32.17% 32.17% 3.0(3.0) 8.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_concordance_of_the_legionfall
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:4000.00

Stack Uptimes

  • concordance_of_the_legionfall_1:32.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:242583
  • name:Concordance of the Legionfall
  • tooltip:Increases Strength by $w1.
  • description:Increases Strength.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Elemental Focus 66.0 48.1 4.6sec 2.6sec 66.82% 71.61% 48.1(55.4) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_elemental_focus
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • elemental_focus_1:28.78%
  • elemental_focus_2:38.04%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:16246
  • name:Elemental Focus
  • tooltip:Your next spell deals {$s1=10}% increased damage and healing.
  • description:{$@spelldesc16164=Your direct damage spell critical strikes increase the damage and healing of your next {$s1=2} spells by $16246s2%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Ember Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_ember_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.10

Stack Uptimes

  • ember_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210658
  • name:Ember Totem
  • tooltip:Increases Flame Shock damage over time by {$s1=10}%.
  • description:{$@spelldesc210657=Summons an Ember Totem near the caster for {$d=120 seconds} that increases damage over time from your Flame Shock by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Lava Surge 20.5 0.7 14.0sec 13.6sec 7.98% 23.50% 0.7(0.7) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lava_surge
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • lava_surge_1:7.98%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:77762
  • name:Lava Surge
  • tooltip:Your next Lava Burst casts instantly.
  • description:The Shaman's next Lava Burst casts instantly.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Well Fed (lavish_suramar_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_lavish_suramar_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:499.71

Stack Uptimes

  • lavish_suramar_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201640
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=500}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Mark of the Claw 12.9 4.3 23.2sec 17.1sec 29.96% 29.96% 4.3(4.3) 12.6

Buff details

  • buff initial source:baseline
  • cooldown name:buff_mark_of_the_claw
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1000.00
  • stat:haste_rating
  • amount:1000.00

Stack Uptimes

  • mark_of_the_claw_1:29.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190909
  • name:Mark of the Claw
  • tooltip:Critical strike and haste increased by {$s1=1000}.
  • description:Critical strike and haste increased by {$s1=1000}.
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of Prolonged Power 2.0 0.0 83.6sec 0.0sec 39.34% 39.34% 0.0(0.0) 2.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_potion_of_prolonged_power
  • max_stacks:1
  • duration:60.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:all
  • amount:2500.00

Stack Uptimes

  • potion_of_prolonged_power_1:39.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:229206
  • name:Potion of Prolonged Power
  • tooltip:All stats increased by {$s1=2500}.
  • description:Drink to increase all stats by {$s1=2500} for {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:1.00
  • default_chance:0.00%
Power of the Maelstrom 8.4 5.9 34.8sec 19.7sec 37.53% 34.13% 5.9(16.2) 0.7

Buff details

  • buff initial source:baseline
  • cooldown name:buff_power_of_the_maelstrom
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:15.00%
  • default_value:-0.00

Stack Uptimes

  • power_of_the_maelstrom_1:6.22%
  • power_of_the_maelstrom_2:6.26%
  • power_of_the_maelstrom_3:25.05%

Trigger Attempt Success

  • trigger_pct:15.03%

Spelldata details

  • id:191877
  • name:Power of the Maelstrom
  • tooltip:Lightning Bolt will trigger Elemental Overload an additional time.
  • description:{$@spelldesc191861=When you cast Lava Burst, you have a chance to supercharge |cFFFFCC99The Fists of Ra-den|r, causing your next $191877n Lightning Bolts to trigger Elemental Overload an additional time.}
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
Resonance Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 300.6(300.6) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_resonance_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • resonance_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202192
  • name:Resonance Totem
  • tooltip:Generates {$s1=1} Maelstrom every $t1 sec.
  • description:{$@spelldesc202188=Summons a Resonance Totem near the caster for {$d=120 seconds} that generates {$202192s1=1} Maelstrom every $202192t1 sec.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Storm Totem 1.0 2.0 0.0sec 113.6sec 100.00% 100.00% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_storm_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • storm_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210651
  • name:Storm Totem
  • tooltip:
  • description:Summons a Storm Totem near the caster for {$d=120 seconds} that increases the chance for Lightning Bolt and Chain Lightning to trigger Elemental Overload by {$s2=10}%.
  • max_stacks:0
  • duration:120.00
  • cooldown:30.00
  • default_chance:0.00%
Stormkeeper 5.0 0.0 61.7sec 61.7sec 10.35% 11.33% 0.0(0.0) 0.2

Buff details

  • buff initial source:baseline
  • cooldown name:buff_stormkeeper
  • max_stacks:3
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormkeeper_1:3.23%
  • stormkeeper_2:3.08%
  • stormkeeper_3:4.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205495
  • name:Stormkeeper
  • tooltip:Your next Lightning Bolt or Chain Lightning will be instant and deal $w1% additional damage.
  • description:Raises |cFFFFCC99The Fist of Ra-den|r to the sky and absorbs all nearby electric energy, causing your next $n casts of Lightning Bolt or Chain Lightning to be instant and deal {$s1=200}% increased damage.
  • max_stacks:0
  • duration:15.00
  • cooldown:60.00
  • default_chance:100.00%
Tailwind Totem 1.0 2.0 0.0sec 113.6sec 100.00% 96.19% 2.0(2.0) 0.0

Buff details

  • buff initial source:baseline
  • cooldown name:buff_tailwind_totem
  • max_stacks:1
  • duration:120.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.98

Stack Uptimes

  • tailwind_totem_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210659
  • name:Tailwind Totem
  • tooltip:Increases haste by {$s1=2}%.
  • description:{$@spelldesc210660=Summons a Tailwind Totem near the caster for {$d=120 seconds} that increases the Shaman's haste by {$s2=10}%.}
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs

Procs

Count Interval
Lava Surge 21.2 13.6sec
Lava Surge: Wasted 0.7 84.1sec
Lava Surge: During Lava Burst 7.5 35.3sec

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Stormkeeper0.6730.0018.3272.2570.00010.979
Fire Elemental0.4070.0011.4800.5720.0003.914
Ascendance6.2800.00275.2126.2130.00075.212
Lava Burst0.8180.00010.5325.4980.00022.720

Resources

Resource Usage Type Count Total Average RPE APR
baseline
earth_shock Maelstrom 49.2 4965.6 100.8 100.8 15550.3
flame_shock Maelstrom 11.3 207.5 18.3 18.3 164654.6
Resource Gains Type Count Total Average Overflow
Lava Burst Maelstrom 95.14 1117.00 (21.36%) 11.74 24.72 2.17%
Lava Burst Overload Maelstrom 49.88 426.63 (8.16%) 8.55 22.32 4.97%
Lightning Bolt Maelstrom 72.97 583.72 (11.16%) 8.00 0.00 0.00%
Lightning Bolt Overload Maelstrom 70.09 417.66 (7.99%) 5.96 2.85 0.68%
Aftershock Maelstrom 60.57 1551.93 (29.68%) 25.62 0.00 0.00%
Resonance Totem Maelstrom 298.58 290.91 (5.56%) 0.97 7.67 2.57%
The Deceiver's Blood Pact Maelstrom 9.87 841.71 (16.10%) 85.24 154.28 15.49%
Resource RPS-Gain RPS-Loss
Maelstrom 17.43 17.24
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 54.92 9.80 125.00

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data baseline Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data baseline Damage Per Second
Count 24999
Mean 1102063.17
Minimum 899109.88
Maximum 1361339.89
Spread ( max - min ) 462230.01
Range [ ( max - min ) / 2 * 100% ] 20.97%
Standard Deviation 62177.0387
5th Percentile 1003857.45
95th Percentile 1208300.81
( 95th Percentile - 5th Percentile ) 204443.35
Mean Distribution
Standard Deviation 393.2500
95.00% Confidence Intervall ( 1101292.41 - 1102833.93 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 123
0.1% Error 12228
0.1 Scale Factor Error with Delta=300 33002265
0.05 Scale Factor Error with Delta=300 132009057
0.01 Scale Factor Error with Delta=300 3300226425
Priority Target DPS
Sample Data baseline Priority Target Damage Per Second
Count 24999
Mean 1102063.17
Minimum 899109.88
Maximum 1361339.89
Spread ( max - min ) 462230.01
Range [ ( max - min ) / 2 * 100% ] 20.97%
Standard Deviation 62177.0387
5th Percentile 1003857.45
95th Percentile 1208300.81
( 95th Percentile - 5th Percentile ) 204443.35
Mean Distribution
Standard Deviation 393.2500
95.00% Confidence Intervall ( 1101292.41 - 1102833.93 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 123
0.1% Error 12228
0.1 Scale Factor Error with Delta=300 33002265
0.05 Scale Factor Error with Delta=300 132009057
0.01 Scale Factor Error with Delta=300 3300226425
DPS(e)
Sample Data baseline Damage Per Second (Effective)
Count 24999
Mean 1102063.17
Minimum 899109.88
Maximum 1361339.89
Spread ( max - min ) 462230.01
Range [ ( max - min ) / 2 * 100% ] 20.97%
Damage
Sample Data baseline Damage
Count 24999
Mean 279863325.90
Minimum 220650694.76
Maximum 351466345.07
Spread ( max - min ) 130815650.30
Range [ ( max - min ) / 2 * 100% ] 23.37%
DTPS
Sample Data baseline Damage Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data baseline Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data baseline Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data baseline Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data baseline Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data baseline Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data baselineTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data baseline Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion
5 0.00 totem_mastery
6 0.00 stormkeeper
Default action list Executed every time the actor is available.
# count action,conditions
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 1.00 potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
0.00 wind_shear
Interrupt of casts and is reliable trigger of Sephuz Secret.
8 0.40 totem_mastery,if=buff.resonance_totem.remains<2
9 3.86 fire_elemental
0.00 storm_elemental
0.00 elemental_mastery
0.00 use_items
0.00 use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
0.00 blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
0.00 berserking,if=!talent.ascendance.enabled|buff.ascendance.up
A 0.00 run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
B 0.00 run_action_list,name=single_asc,if=talent.ascendance.enabled
C 0.00 run_action_list,name=single_if,if=talent.icefury.enabled
D 0.00 run_action_list,name=single_lr,if=talent.lightning_rod.enabled
actions.single_asc Single Target Action Priority List for Ascendance Spec
# count action,conditions
E 2.00 ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
F 2.45 flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
G 2.07 flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
0.00 elemental_blast
Keep your EB always on Cooldown.
0.00 earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
H 19.31 earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
I 4.00 stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
Keep SK for large or soon add waves.
0.00 liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
J 6.33 lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
K 95.43 lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
L 6.80 flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
M 29.93 earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
N 1.60 totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
0.00 lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
O 18.45 lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
0.00 chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
P 48.54 lightning_bolt
0.00 flame_shock,moving=1,target_if=refreshable
0.00 earth_shock,moving=1
0.00 flame_shock,moving=1,if=movement.distance>6

Sample Sequence

0124569FKKGPPKPEKKHKKKKKHKKKKHKKMPPPPPMKPLKPMPPKPMPPPKMPPPPKMIPPPKMLPPPKMPPPMKPPMPPKPMP97PKMLOOOKMMHNPKOMOOPKIMLPPPKPMPPPKKMKPPMKKPKMHKPLPPMKPPMMPKOMMHHOGKOMIMHHKPPMPKEKKKKKHH9KKKKKLMOPKMNPPPPKMKPMKKKMLPPKPIPMPPKPMPKPKMMPPPKKHHHKKKFKKHKOMKKHKKKKKHLP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 1 food baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 2 augmentation baseline 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom
Pre precombat 4 potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom potion_of_prolonged_power
Pre precombat 5 totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
Pre precombat 6 stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:00.000 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/125: 0% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.113 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/125: 1% maelstrom bloodlust, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:01.969 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 0.3/125: 0% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:03.108 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 14.3/125: 11% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:04.247 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 36.3/125: 29% maelstrom bloodlust, elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.103 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.3/125: 19% maelstrom bloodlust, elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:05.958 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.3/125: 30% maelstrom bloodlust, lava_surge, elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:06.812 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.3/125: 37% maelstrom bloodlust, lava_surge, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:07.668 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.3/125: 55% maelstrom bloodlust, elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.523 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:08.523 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.3/125: 67% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:09.662 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 96.3/125: 77% maelstrom bloodlust, ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:10.802 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.3/125: 95% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:11.657 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.7/125: 29% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:12.797 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:13.652 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.7/125: 65% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:14.791 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 93.7/125: 75% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:15.929 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 115.7/125: 93% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.069 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:17.924 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 46.5/125: 37% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:19.064 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:20.204 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:21.342 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 95.5/125: 76% maelstrom bloodlust, ascendance, lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:22.199 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 117.5/125: 94% maelstrom bloodlust, ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:23.055 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom bloodlust, ascendance, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:24.193 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.6/125: 40% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:25.333 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.6/125: 57% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:26.188 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.9/125: 26% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:27.328 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.9/125: 33% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:28.467 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 49.9/125: 40% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:29.606 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.9/125: 47% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:30.746 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.9/125: 54% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:31.887 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:32.742 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.7/125: 25% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:33.882 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.7/125: 35% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.019 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:35.875 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 54.7/125: 44% maelstrom bloodlust, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:36.731 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.7/125: 54% maelstrom bloodlust, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:37.871 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.7/125: 61% maelstrom bloodlust, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:38.709 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 30.5/125: 24% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:39.826 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 39.5/125: 32% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:40.944 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom bloodlust, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:42.063 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.5/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
0:43.515 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:44.625 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.5/125: 20% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:46.106 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.5/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:47.588 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.5/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:49.067 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:50.548 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 85.5/125: 68% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:51.660 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.0/125: 22% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:53.139 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 37.0/125: 30% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:54.619 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.0/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:56.102 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.0/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
0:57.583 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 83.0/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
0:59.064 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 97.0/125: 78% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:00.177 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 39.8/125: 32% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:01.287 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.8/125: 33% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:02.401 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 55.8/125: 45% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:03.514 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 64.8/125: 52% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:04.603 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 79.8/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:06.055 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 93.8/125: 75% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:07.146 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 38.7/125: 31% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:08.238 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 25.7/125: 21% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:09.690 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.7/125: 28% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:11.172 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.7/125: 36% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:12.654 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 59.7/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:14.134 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.7/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:15.244 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:16.723 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.4/125: 35% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:18.205 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.4/125: 48% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:19.685 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 74.4/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:20.799 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 29.6/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:22.279 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:23.730 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:25.182 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.6/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:26.271 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.7/125: 20% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:27.724 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
1:29.177 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.7/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:30.629 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 68.7/125: 55% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
1:32.078 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 78.7/125: 63% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:33.189 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.1/125: 25% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:34.670 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 40.1/125: 32% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:35.781 default 7 potion Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
1:35.781 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.1/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:37.262 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.1/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:38.743 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.1/125: 61% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:39.854 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 23.9/125: 19% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:40.966 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 10.9/125: 9% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
1:42.446 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 20.9/125: 17% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:43.929 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 35.9/125: 29% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:45.409 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.9/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:46.890 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.9/125: 62% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:48.002 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 110.7/125: 89% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:49.113 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.224 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:50.979 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:52.459 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:53.939 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.5/125: 54% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:55.420 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.5/125: 62% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:56.533 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 36.6/125: 29% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:58.013 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 45.6/125: 36% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
1:59.493 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.6/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:00.974 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:02.454 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 102.6/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:03.564 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 112.6/125: 90% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:04.676 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 35.2/125: 28% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:05.788 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 22.2/125: 18% maelstrom elemental_focus(2), stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:06.900 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.2/125: 25% maelstrom elemental_focus, stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:08.011 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 40.2/125: 32% maelstrom elemental_focus(2), stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, potion_of_prolonged_power
2:09.123 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 49.2/125: 39% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:10.574 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.2/125: 51% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:12.025 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.2/125: 58% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw, potion_of_prolonged_power
2:13.115 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 28.8/125: 23% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:14.567 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.8/125: 31% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:16.018 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 47.8/125: 38% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:17.471 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.8/125: 46% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw, potion_of_prolonged_power
2:18.561 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 76.8/125: 61% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:20.042 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 89.8/125: 72% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:21.153 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 37.5/125: 30% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:22.265 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:23.746 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:25.227 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:26.338 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.3/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:27.818 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 43.3/125: 35% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:28.929 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 65.3/125: 52% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:30.411 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 75.3/125: 60% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:31.522 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 94.3/125: 75% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:32.634 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:33.745 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.4/125: 31% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:35.224 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.4/125: 42% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, potion_of_prolonged_power
2:36.707 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:37.797 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:39.247 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:40.699 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.4/125: 61% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:41.788 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 30.2/125: 24% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:43.238 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 44.2/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
2:44.717 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.2/125: 50% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
2:46.198 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 77.2/125: 62% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:47.286 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.3/125: 87% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:48.375 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.7/125: 27% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:49.827 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 42.7/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:51.279 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 62.7/125: 50% maelstrom power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:52.730 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 71.7/125: 57% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:53.841 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 106.0/125: 85% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:54.954 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:56.065 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:57.179 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
2:58.659 single_asc G flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 48.5/125: 39% maelstrom power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
2:59.747 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom elemental_focus(2), power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:01.198 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom elemental_focus, power_of_the_maelstrom, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:02.650 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 79.5/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:03.738 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 110.2/125: 88% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:04.826 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 111.2/125: 89% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:05.939 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:07.050 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:08.161 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:09.643 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 52.5/125: 42% maelstrom stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:10.754 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.5/125: 49% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:11.864 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 76.5/125: 61% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:12.973 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 24.3/125: 19% maelstrom stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:14.085 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 33.3/125: 27% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.567 single_asc E ascendance Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:15.567 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.3/125: 38% maelstrom ascendance, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:17.046 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.3/125: 48% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:18.526 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.3/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:20.007 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.3/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:21.489 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 110.3/125: 88% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:22.970 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:24.059 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:25.148 default 9 fire_elemental Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:26.238 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.5/125: 32% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:27.689 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 53.5/125: 43% maelstrom ascendance, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:29.140 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 66.5/125: 53% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:30.622 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 80.5/125: 64% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:32.102 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 102.5/125: 82% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:33.554 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 116.5/125: 93% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:34.644 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 103.5/125: 83% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:35.733 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:37.184 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 41.4/125: 33% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:38.636 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:40.117 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.4/125: 56% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.229 single_asc N totem_mastery Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:41.984 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 32.4/125: 26% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:43.465 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 42.4/125: 34% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:44.945 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 57.4/125: 46% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:46.426 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 67.4/125: 54% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:47.905 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 82.4/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
3:49.385 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 102.4/125: 82% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:50.475 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 41.0/125: 33% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:51.565 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 63.0/125: 50% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:53.017 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 72.0/125: 58% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:54.107 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 28.6/125: 23% maelstrom lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:55.195 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 50.6/125: 40% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
3:56.646 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 64.6/125: 52% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:57.759 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 95.6/125: 76% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
3:58.870 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 30.1/125: 24% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
3:59.980 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 17.1/125: 14% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:01.460 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 27.1/125: 22% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:02.940 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 36.1/125: 29% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:04.423 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 50.1/125: 40% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:05.904 single_asc I stormkeeper Fluffy_Pillow 220000.0/220000: 100% mana | 59.1/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:06.994 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 66.1/125: 53% maelstrom elemental_focus, stormkeeper(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:08.083 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 75.1/125: 60% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:09.174 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 23.6/125: 19% maelstrom elemental_focus(2), stormkeeper(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall, mark_of_the_claw
4:10.263 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus, stormkeeper, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:11.353 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 48.6/125: 39% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:12.803 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 61.6/125: 49% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:14.255 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 80.6/125: 64% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:15.365 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 31.6/125: 25% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:16.845 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 40.6/125: 32% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:17.956 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 59.6/125: 48% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:19.436 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 69.6/125: 56% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:20.916 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 82.6/125: 66% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem
4:22.029 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 108.2/125: 87% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:23.140 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 33.6/125: 27% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:24.621 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 43.6/125: 35% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:26.071 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 58.6/125: 47% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:27.524 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 74.6/125: 60% maelstrom resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:28.975 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.6/125: 70% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:30.064 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 118.6/125: 95% maelstrom lava_surge, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:31.154 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom lava_surge, elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:32.245 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:33.334 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom ascendance, lava_surge, resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:34.425 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:35.907 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:37.390 single_asc F flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 96.5/125: 77% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:38.478 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 92.5/125: 74% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:39.929 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 105.5/125: 84% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:41.380 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:42.469 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 38.5/125: 31% maelstrom elemental_focus(2), power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem, mark_of_the_claw
4:43.920 single_asc O lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 51.5/125: 41% maelstrom elemental_focus, power_of_the_maelstrom(3), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:45.400 single_asc M earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 70.5/125: 56% maelstrom elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:46.511 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 98.5/125: 79% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:47.992 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 111.5/125: 89% maelstrom ascendance, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:49.472 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/125: 100% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:50.583 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 47.5/125: 38% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:52.064 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 60.5/125: 48% maelstrom ascendance, lava_surge, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:53.177 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 73.5/125: 59% maelstrom ascendance, elemental_focus(2), power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:54.658 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 87.5/125: 70% maelstrom ascendance, elemental_focus, power_of_the_maelstrom(2), resonance_totem, storm_totem, ember_totem, tailwind_totem, concordance_of_the_legionfall
4:56.136 single_asc K lava_burst Fluffy_Pillow 220000.0/220000: 100% mana | 109.5/125: 88% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:57.617 single_asc H earth_shock Fluffy_Pillow 220000.0/220000: 100% mana | 123.5/125: 99% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem
4:58.730 single_asc L flame_shock Fluffy_Pillow 220000.0/220000: 100% mana | 47.4/125: 38% maelstrom elemental_focus(2), resonance_totem, storm_totem, ember_totem, tailwind_totem
4:59.842 single_asc P lightning_bolt Fluffy_Pillow 220000.0/220000: 100% mana | 34.4/125: 28% maelstrom elemental_focus, resonance_totem, storm_totem, ember_totem, tailwind_totem

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9353 9028 0
Stamina 85193 85193 46429
Intellect 57937 55706 45728 (22394)
Spirit 0 0 0
Health 5111580 5111580 0
Mana 220000 220000 0
Maelstrom 125 125 0
Spell Power 57937 55706 0
Crit 19.30% 19.30% 5718
Haste 32.83% 32.83% 12312
Damage / Heal Versatility 5.52% 5.52% 2624
Attack Power 9353 9028 0
Mastery 52.52% 52.52% 6135
Armor 3319 3319 3319
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 940.00
Local Head Helmet of the Skybreaker
ilevel: 930, stats: { 431 Armor, +4305 Sta, +2870 AgiInt, +1043 Mastery, +805 Haste }
Local Neck String of Extracted Incisors
ilevel: 930, stats: { +2422 Sta, +2112 Haste, +1408 Vers }, enchant: mark_of_the_claw
Local Shoulders Mantle of Waning Radiance
ilevel: 930, stats: { 398 Armor, +3229 Sta, +2153 AgiInt, +901 Haste, +485 Mastery }
Local Chest Harness of the Skybreaker
ilevel: 930, stats: { 531 Armor, +4305 Sta, +2870 AgiInt, +1241 Haste, +607 Vers }
Local Waist Waistguard of Interminable Unity
ilevel: 930, stats: { 299 Armor, +3229 Sta, +2153 AgiInt, +871 Mastery, +515 Haste }
Local Legs Legguards of the Skybreaker
ilevel: 930, stats: { 465 Armor, +4305 Sta, +2870 AgiInt, +1162 Crit, +686 Haste }
Local Feet The Deceiver's Blood Pact
ilevel: 970, stats: { 414 Armor, +4687 Sta, +3124 AgiInt, +1035 Crit, +575 Haste }
Local Wrists Pain-Singed Armguards
ilevel: 930, stats: { 232 Armor, +2422 Sta, +1615 AgiInt, +676 Haste, +364 Crit }
Local Hands Smoldering Heart
ilevel: 970, stats: { 376 Armor, +4687 Sta, +3124 AgiInt, +862 Haste, +747 Mastery }
Local Finger1 Seal of the Second Duumvirate
ilevel: 940, stats: { +2658 Sta, +2030 Haste, +1709 Crit }, enchant: { +200 Haste }
Local Finger2 Scaled Band of Servitude
ilevel: 930, stats: { +2422 Sta, +2011 Mastery, +1509 Haste }, enchant: { +200 Haste }
Local Back Drape of the Skybreaker
ilevel: 930, stats: { 173 Armor, +2422 Sta, +1615 StrAgiInt, +609 Vers, +430 Crit }, enchant: { +200 Int }
Local Main Hand The Fist of Ra-den
ilevel: 954, weapon: { 4342 - 8065, 2.6 }, stats: { +1538 Int, +2308 Sta, +440 Crit, +423 Mastery, +19578 Int }, relics: { +67 ilevels, +70 ilevels, +67 ilevels }
Local Off Hand The Highkeeper's Ward
ilevel: 954, stats: { +2018 Int, +3028 Sta, +578 Crit, +555 Mastery }

Talents

Level
15 Path of Flame (Elemental Shaman) Earthen Rage (Elemental Shaman) Totem Mastery (Elemental Shaman)
30 Gust of Wind Ancestral Guidance (Elemental Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Aftershock (Elemental Shaman) Ancestral Swiftness Elemental Mastery
75 Elemental Fusion (Elemental Shaman) Primal Elementalist (Elemental Shaman) Elemental Blast (Elemental Shaman)
90 Liquid Magma Totem (Elemental Shaman) Storm Elemental (Elemental Shaman) Echo of the Elements
100 Ascendance (Elemental Shaman) Lightning Rod (Elemental Shaman) Icefury (Elemental Shaman)

Profile

shaman="baseline"
spec=elemental
level=110
race=tauren
role=spell
position=back
talents=3111231
artifact=40:0:0:0:0:291:1:292:1:293:1:294:1:295:1:296:1:297:1:298:4:299:4:300:4:301:4:302:4:303:4:304:4:305:4:306:4:1350:1:1387:1:1589:4:1590:1:1591:1:1592:1:1683:1

# Default consumables
potion=prolonged_power
flask=whispered_pact
food=lavish_suramar_feast
augmentation=defiled

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/totem_mastery
actions.precombat+=/stormkeeper

# Executed every time the actor is available.
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions=bloodlust,if=target.health.pct<25|time>0.500
# In-combat potion is preferentially linked to your Elemental, unless combat will end shortly
actions+=/potion,if=cooldown.fire_elemental.remains>280|target.time_to_die<=60
# Interrupt of casts and is reliable trigger of Sephuz Secret.
actions+=/wind_shear
actions+=/totem_mastery,if=buff.resonance_totem.remains<2
actions+=/fire_elemental
actions+=/storm_elemental
actions+=/elemental_mastery
actions+=/use_items
actions+=/use_item,name=gnawed_thumb_ring,if=equipped.gnawed_thumb_ring&(talent.ascendance.enabled&!buff.ascendance.up|!talent.ascendance.enabled)
actions+=/blood_fury,if=!talent.ascendance.enabled|buff.ascendance.up|cooldown.ascendance.remains>50
actions+=/berserking,if=!talent.ascendance.enabled|buff.ascendance.up
actions+=/run_action_list,name=aoe,if=active_enemies>2&(spell_targets.chain_lightning>2|spell_targets.lava_beam>2)
actions+=/run_action_list,name=single_asc,if=talent.ascendance.enabled
actions+=/run_action_list,name=single_if,if=talent.icefury.enabled
actions+=/run_action_list,name=single_lr,if=talent.lightning_rod.enabled

# Multi target action priority list
actions.aoe=stormkeeper
actions.aoe+=/ascendance
actions.aoe+=/liquid_magma_totem
actions.aoe+=/flame_shock,if=spell_targets.chain_lightning<4&maelstrom>=20,target_if=refreshable
actions.aoe+=/earthquake
actions.aoe+=/lava_burst,if=dot.flame_shock.remains>cast_time&buff.lava_surge.up&!talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/elemental_blast,if=!talent.lightning_rod.enabled&spell_targets.chain_lightning<5|talent.lightning_rod.enabled&spell_targets.chain_lightning<4
actions.aoe+=/lava_beam
actions.aoe+=/chain_lightning,target_if=debuff.lightning_rod.down
actions.aoe+=/chain_lightning
actions.aoe+=/lava_burst,moving=1
actions.aoe+=/flame_shock,moving=1,target_if=refreshable

# Single Target Action Priority List for Ascendance Spec
actions.single_asc=ascendance,if=dot.flame_shock.remains>buff.ascendance.duration&(time>=60|buff.bloodlust.up)&cooldown.lava_burst.remains>0&!buff.stormkeeper.up
actions.single_asc+=/flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_asc+=/flame_shock,if=maelstrom>=20&remains<=buff.ascendance.duration&cooldown.ascendance.remains+buff.ascendance.duration<=duration
# Keep your EB always on Cooldown.
actions.single_asc+=/elemental_blast
actions.single_asc+=/earthquake,if=buff.echoes_of_the_great_sundering.up&!buff.ascendance.up&maelstrom>=86
actions.single_asc+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_asc+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_asc+=/lava_burst,if=dot.flame_shock.remains>cast_time&(cooldown_react|buff.ascendance.up)
actions.single_asc+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_asc+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_asc+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_asc+=/lava_beam,if=active_enemies>1&spell_targets.lava_beam>1
actions.single_asc+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_asc+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_asc+=/lightning_bolt
actions.single_asc+=/flame_shock,moving=1,target_if=refreshable
actions.single_asc+=/earth_shock,moving=1
actions.single_asc+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Ice Fury Spec
actions.single_if=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up&maelstrom>=86
actions.single_if+=/frost_shock,if=buff.icefury.up&maelstrom>=111&!buff.ascendance.up
# Keep your EB always on Cooldown.
actions.single_if+=/elemental_blast
actions.single_if+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon spawning add waves.
actions.single_if+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/icefury,if=(raid_event.movement.in<5|maelstrom<=101&artifact.swelling_maelstrom.enabled|!artifact.swelling_maelstrom.enabled&maelstrom<=76)&!buff.ascendance.up
actions.single_if+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&buff.stormkeeper.up&spell_targets.chain_lightning<3
actions.single_if+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_if+=/frost_shock,if=buff.icefury.up&((maelstrom>=20&raid_event.movement.in>buff.icefury.remains)|buff.icefury.remains<(1.5*spell_haste*buff.icefury.stack+1))
actions.single_if+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
actions.single_if+=/frost_shock,moving=1,if=buff.icefury.up
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_if+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_if+=/totem_mastery,if=buff.resonance_totem.remains<10
actions.single_if+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_if+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_if+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_if+=/lightning_bolt
actions.single_if+=/flame_shock,moving=1,target_if=refreshable
actions.single_if+=/earth_shock,moving=1
actions.single_if+=/flame_shock,moving=1,if=movement.distance>6

# Single Target Action Priority List for Lightning Rod Spec
actions.single_lr=flame_shock,if=!ticking|dot.flame_shock.remains<=gcd
# Keep your EB always on Cooldown.
actions.single_lr+=/elemental_blast
actions.single_lr+=/earthquake,if=buff.echoes_of_the_great_sundering.up
actions.single_lr+=/earth_shock,if=maelstrom>=117|!artifact.swelling_maelstrom.enabled&maelstrom>=92
# Keep SK for large or soon add waves.
actions.single_lr+=/stormkeeper,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/liquid_magma_totem,if=raid_event.adds.count<3|raid_event.adds.in>50
actions.single_lr+=/lava_burst,if=dot.flame_shock.remains>cast_time&cooldown_react
actions.single_lr+=/flame_shock,if=maelstrom>=20&buff.elemental_focus.up,target_if=refreshable
# If you equipped Smoldering Heart, Deceivers Blood Pact and skilled Aftershock, you essentially gamble for procs.
actions.single_lr+=/earth_shock,if=maelstrom>=111|!artifact.swelling_maelstrom.enabled&maelstrom>=86|equipped.smoldering_heart&equipped.the_deceivers_blood_pact&maelstrom>70&talent.aftershock.enabled
actions.single_lr+=/totem_mastery,if=buff.resonance_totem.remains<10|(buff.resonance_totem.remains<(buff.ascendance.duration+cooldown.ascendance.remains)&cooldown.ascendance.remains<15)
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt,if=buff.power_of_the_maelstrom.up&spell_targets.chain_lightning<3
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1,target_if=debuff.lightning_rod.down
actions.single_lr+=/chain_lightning,if=active_enemies>1&spell_targets.chain_lightning>1
actions.single_lr+=/lightning_bolt,target_if=debuff.lightning_rod.down
actions.single_lr+=/lightning_bolt
actions.single_lr+=/flame_shock,moving=1,target_if=refreshable
actions.single_lr+=/earth_shock,moving=1
actions.single_lr+=/flame_shock,moving=1,if=movement.distance>6

head=helmet_of_the_skybreaker,id=147178,ilevel=930
neck=string_of_extracted_incisors,id=147013,ilevel=930,enchant=mark_of_the_claw
shoulders=mantle_of_waning_radiance,id=147054,ilevel=930
back=drape_of_the_skybreaker,id=147176,ilevel=930,enchant=binding_of_intellect
chest=harness_of_the_skybreaker,id=147175,ilevel=930
wrists=painsinged_armguards,id=147057,ilevel=930
hands=smoldering_heart,id=151819,ilevel=970
waist=waistguard_of_interminable_unity,id=147056,ilevel=930
legs=legguards_of_the_skybreaker,id=147179,ilevel=930
feet=the_deceivers_blood_pact,id=137035,ilevel=970
finger1=seal_of_the_second_duumvirate,id=147195,ilevel=940,enchant=200haste
finger2=scaled_band_of_servitude,id=147020,ilevel=930,enchant=200haste
main_hand=the_fist_of_raden,id=128935,bonus_id=744,gem_id=147112/147095/147112,relic_ilevel=930/940/930
off_hand=the_highkeepers_ward,id=128936

# Gear Summary
# gear_ilvl=939.86
# gear_stamina=46429
# gear_intellect=45728
# gear_crit_rating=5718
# gear_haste_rating=12312
# gear_mastery_rating=6135
# gear_versatility_rating=2624
# gear_armor=3319
# set_bonus=tier20_2pc=1
# set_bonus=tier20_4pc=1

Simulation & Raid Information

Iterations: 25063
Threads: 64
Confidence: 95.00%
Fight Length (fixed time): 296 - 304 ( 300.0 )

Performance:

Total Events Processed: 1200078488
Max Event Queue: 557
Sim Seconds: 7518919
CPU Seconds: 2207.1881
Physical Seconds: 45.5440
Speed Up: 3407

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Charm + Sentinel Charm + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.64sec 0 300.00sec
Charm + Sentinel Charm + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel earth_shock 8042 85166676 283888 10.33 1199388 3444266 51.6 51.6 20.1% 0.0% 0.0% 0.0% 5.64sec 85166676 300.00sec
Charm + Sentinel Charm + Sentinel fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 99.58sec 0 300.00sec
Charm + Sentinel Charm + Sentinel flame_shock 188389 2454044 8180 2.27 90004 262791 11.3 11.3 73.2% 0.0% 0.0% 0.0% 27.13sec 37534102 300.00sec
Charm + Sentinel Charm + Sentinel flame_shock ticks -188389 35080058 116934 43.48 49614 198865 11.3 217.4 74.9% 0.0% 0.0% 0.0% 27.13sec 37534102 300.00sec
Charm + Sentinel Charm + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel lava_burst 51505 93033695 310112 19.67 0 945708 98.6 98.4 100.0% 0.0% 0.0% 0.0% 3.02sec 93033695 300.00sec
Charm + Sentinel Charm + Sentinel lava_burst_overload 77451 44381857 147939 11.78 0 753734 59.0 58.9 100.0% 0.0% 0.0% 0.0% 5.03sec 44381857 300.00sec
Charm + Sentinel Charm + Sentinel volcanic_inferno 205533 4103186 13677 14.66 46305 94458 73.3 73.3 20.1% 0.0% 0.0% 0.0% 3.84sec 4103186 300.00sec
Charm + Sentinel Charm + Sentinel lightning_bolt 188196 25032969 83443 14.64 248392 714500 73.2 73.2 20.1% 0.0% 0.0% 0.0% 4.02sec 25032969 300.00sec
Charm + Sentinel Charm + Sentinel lightning_bolt_overload 45284 22385322 74618 15.16 214734 617426 75.8 75.8 20.0% 0.0% 0.0% 0.0% 5.02sec 22385322 300.00sec
Charm + Sentinel Charm + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Sentinel Charm + Sentinel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.44sec 0 300.00sec
Charm + Sentinel Charm + Sentinel spectral_blast 246442 5318311 17728 7.22 121869 248614 36.1 36.1 20.0% 0.0% 0.0% 0.0% 7.36sec 5318311 300.00sec
Charm + Sentinel Charm + Sentinel spectral_bolt 242571 10959245 36531 18.38 98655 201256 91.9 91.9 20.0% 0.0% 0.0% 0.0% 2.86sec 10959245 300.00sec
Charm + Sentinel Charm + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.00sec
Charm + Sentinel Charm + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.48sec 0 300.00sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental fire_blast 57984 42630714 212862 27.33 389081 778140 91.2 91.2 20.1% 0.0% 0.0% 0.0% 3.24sec 42630714 200.27sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental immolate 118297 1422067 7101 3.08 115100 230224 10.3 10.3 20.0% 0.0% 0.0% 0.0% 30.61sec 6701634 200.27sec
Charm + Sentinel Charm + Sentinel_primal_fire_elemental immolate ticks -118297 5279568 17599 21.26 41371 82779 10.3 106.3 20.1% 0.0% 0.0% 0.0% 30.61sec 6701634 200.27sec
Charm + Sentinel Charm + Sentinel_greater_lightning_elemental lightning_blast 191726 7106702 177668 55.76 159022 318137 37.2 37.2 20.2% 0.0% 0.0% 0.0% 7.00sec 7106702 40.00sec
Charm + Terror Charm + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.27sec 0 300.00sec
Charm + Terror Charm + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror earth_shock 8042 86738604 289128 10.10 1195028 3428708 50.5 50.5 23.4% 0.0% 0.0% 0.0% 5.78sec 86738604 300.00sec
Charm + Terror Charm + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 98.26sec 0 300.00sec
Charm + Terror Charm + Terror flame_shock 188389 2488315 8294 2.27 90092 262675 11.3 11.3 75.1% 0.0% 0.0% 0.0% 27.12sec 38118049 300.00sec
Charm + Terror Charm + Terror flame_shock ticks -188389 35629734 118766 43.55 49647 198307 11.3 217.7 76.7% 0.0% 0.0% 0.0% 27.12sec 38118049 300.00sec
Charm + Terror Charm + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror lava_burst 51505 94501539 315004 19.67 0 960623 98.6 98.4 100.0% 0.0% 0.0% 0.0% 3.01sec 94501539 300.00sec
Charm + Terror Charm + Terror lava_burst_overload 77451 39440111 131467 10.30 0 765637 51.6 51.5 100.0% 0.0% 0.0% 0.0% 5.66sec 39440111 300.00sec
Charm + Terror Charm + Terror volcanic_inferno 205533 4214661 14049 14.65 46305 94457 73.2 73.2 23.3% 0.0% 0.0% 0.0% 3.83sec 4214661 300.00sec
Charm + Terror Charm + Terror lightning_bolt 188196 26481727 88272 14.88 247885 711567 74.4 74.4 23.3% 0.0% 0.0% 0.0% 3.95sec 26481727 300.00sec
Charm + Terror Charm + Terror lightning_bolt_overload 45284 22001920 73340 14.25 214599 618184 71.2 71.2 23.4% 0.0% 0.0% 0.0% 5.27sec 22001920 300.00sec
Charm + Terror Charm + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Terror Charm + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.63sec 0 300.00sec
Charm + Terror Charm + Terror terror_from_below 242524 15321392 51071 1.99 1233906 2517168 10.0 10.0 23.6% 0.0% 0.0% 0.0% 28.67sec 15321392 300.00sec
Charm + Terror Charm + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.48sec 0 300.00sec
Charm + Terror Charm + Terror_primal_fire_elemental fire_blast 57984 44519376 218720 27.36 388885 777822 92.8 92.8 23.3% 0.0% 0.0% 0.0% 3.19sec 44519376 203.54sec
Charm + Terror Charm + Terror_primal_fire_elemental immolate 118297 1479613 7269 3.07 115059 230102 10.4 10.4 23.3% 0.0% 0.0% 0.0% 30.25sec 6975286 203.54sec
Charm + Terror Charm + Terror_primal_fire_elemental immolate ticks -118297 5495673 18319 21.57 41332 82657 10.4 107.8 23.3% 0.0% 0.0% 0.0% 30.25sec 6975286 203.54sec
Charm + Terror Charm + Terror_greater_lightning_elemental lightning_blast 191726 7295742 182394 55.76 158998 318037 37.2 37.2 23.4% 0.0% 0.0% 0.0% 7.00sec 7295742 40.00sec
Charm + Thurible Charm + Thurible ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.66sec 0 300.00sec
Charm + Thurible Charm + Thurible augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible earth_shock 8042 85193223 283977 10.10 1225058 3519160 50.5 50.5 20.1% 0.0% 0.0% 0.0% 5.78sec 85193223 300.00sec
Charm + Thurible Charm + Thurible fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 99.29sec 0 300.00sec
Charm + Thurible Charm + Thurible flame_shock 188389 2518121 8394 2.26 92393 269710 11.3 11.3 73.4% 0.0% 0.0% 0.0% 27.11sec 38573405 300.00sec
Charm + Thurible Charm + Thurible flame_shock ticks -188389 36055283 120184 43.55 50925 204079 11.3 217.7 74.9% 0.0% 0.0% 0.0% 27.11sec 38573405 300.00sec
Charm + Thurible Charm + Thurible flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible lava_burst 51505 95547836 318492 19.69 0 970352 98.7 98.5 100.0% 0.0% 0.0% 0.0% 2.99sec 95547836 300.00sec
Charm + Thurible Charm + Thurible lava_burst_overload 77451 39953126 133177 10.33 0 773339 51.8 51.7 100.0% 0.0% 0.0% 0.0% 5.67sec 39953126 300.00sec
Charm + Thurible Charm + Thurible volcanic_inferno 205533 4218258 14061 14.69 47531 96958 73.5 73.5 20.0% 0.0% 0.0% 0.0% 3.75sec 4218258 300.00sec
Charm + Thurible Charm + Thurible lightning_bolt 188196 26000590 86668 14.87 253741 731818 74.3 74.3 20.1% 0.0% 0.0% 0.0% 3.99sec 26000590 300.00sec
Charm + Thurible Charm + Thurible lightning_bolt_overload 45284 21581980 71940 14.24 219847 632764 71.2 71.2 20.2% 0.0% 0.0% 0.0% 5.31sec 21581980 300.00sec
Charm + Thurible Charm + Thurible piercing_anguish 246751 9698139 32327 3.29 487076 993635 16.6 16.4 20.3% 0.0% 0.0% 0.0% 17.83sec 9698139 300.00sec
Charm + Thurible Charm + Thurible potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Thurible Charm + Thurible stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
Charm + Thurible Charm + Thurible totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.75sec 0 300.00sec
Charm + Thurible Charm + Thurible_primal_fire_elemental fire_blast 57984 43814561 218515 27.35 399328 798694 91.4 91.4 20.1% 0.0% 0.0% 0.0% 3.23sec 43814561 200.51sec
Charm + Thurible Charm + Thurible_primal_fire_elemental immolate 118297 1459150 7277 3.08 118143 236218 10.3 10.3 20.1% 0.0% 0.0% 0.0% 30.59sec 6881322 200.51sec
Charm + Thurible Charm + Thurible_primal_fire_elemental immolate ticks -118297 5422172 18074 21.29 42436 84866 10.3 106.4 20.0% 0.0% 0.0% 0.0% 30.59sec 6881322 200.51sec
Charm + Thurible Charm + Thurible_greater_lightning_elemental lightning_blast 191726 7285266 182132 55.76 163208 326476 37.2 37.2 20.1% 0.0% 0.0% 0.0% 7.01sec 7285266 40.00sec
Charm + Tome Charm + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.32sec 0 300.00sec
Charm + Tome Charm + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome earth_shock 8042 88485027 294949 10.04 1254772 3591899 50.2 50.2 21.7% 0.0% 0.0% 0.0% 5.79sec 88485027 300.00sec
Charm + Tome Charm + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 98.75sec 0 300.00sec
Charm + Tome Charm + Tome flame_shock 188389 2596729 8656 2.27 94552 275742 11.3 11.3 74.2% 0.0% 0.0% 0.0% 27.11sec 39461630 300.00sec
Charm + Tome Charm + Tome flame_shock ticks -188389 36864901 122883 43.30 52131 208501 11.3 216.5 75.6% 0.0% 0.0% 0.0% 27.11sec 39461630 300.00sec
Charm + Tome Charm + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome insidious_corruption ticks -243941 4410598 14702 9.40 77649 158363 5.0 47.0 20.1% 0.0% 0.0% 0.0% 63.21sec 4410598 300.00sec
Charm + Tome Charm + Tome lava_burst 51505 97820236 326067 19.62 0 997391 98.3 98.1 100.0% 0.0% 0.0% 0.0% 3.01sec 97820236 300.00sec
Charm + Tome Charm + Tome lava_burst_overload 77451 40840748 136135 10.28 0 794941 51.5 51.4 100.0% 0.0% 0.0% 0.0% 5.64sec 40840748 300.00sec
Charm + Tome Charm + Tome volcanic_inferno 205533 4349779 14499 14.63 48607 99163 73.2 73.2 21.5% 0.0% 0.0% 0.0% 3.80sec 4349779 300.00sec
Charm + Tome Charm + Tome lightning_bolt 188196 26814449 89381 14.73 262216 732910 73.6 73.6 21.7% 0.0% 0.0% 0.0% 4.02sec 26814449 300.00sec
Charm + Tome Charm + Tome lightning_bolt_overload 45284 22237938 74126 14.12 226817 634021 70.6 70.6 21.7% 0.0% 0.0% 0.0% 5.34sec 22237938 300.00sec
Charm + Tome Charm + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Charm + Tome Charm + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 300.00sec
Charm + Tome Charm + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.85sec 0 300.00sec
Charm + Tome Charm + Tome_primal_fire_elemental fire_blast 57984 45465016 225629 27.24 408265 816368 91.5 91.5 21.7% 0.0% 0.0% 0.0% 3.23sec 45465016 201.50sec
Charm + Tome Charm + Tome_primal_fire_elemental immolate 118297 1517126 7529 3.08 120771 241478 10.4 10.4 21.3% 0.0% 0.0% 0.0% 30.44sec 7133881 201.50sec
Charm + Tome Charm + Tome_primal_fire_elemental immolate ticks -118297 5616755 18723 21.28 43412 86861 10.4 106.4 21.6% 0.0% 0.0% 0.0% 30.44sec 7133881 201.50sec
Charm + Tome Charm + Tome_greater_lightning_elemental lightning_blast 191726 7418903 185473 55.50 166923 333970 37.0 37.0 20.1% 0.0% 0.0% 0.0% 7.03sec 7418903 40.00sec
Sentinel + Terror Sentinel + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.52sec 0 300.00sec
Sentinel + Terror Sentinel + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror earth_shock 8042 83120341 277067 10.08 1146992 3293514 50.4 50.4 23.4% 0.0% 0.0% 0.0% 5.80sec 83120341 300.00sec
Sentinel + Terror Sentinel + Terror fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 100.48sec 0 300.00sec
Sentinel + Terror Sentinel + Terror flame_shock 188389 2349474 7832 2.27 85842 251004 11.3 11.3 73.6% 0.0% 0.0% 0.0% 27.12sec 34683809 300.00sec
Sentinel + Terror Sentinel + Terror flame_shock ticks -188389 32334334 107781 42.37 47321 188805 11.3 211.8 74.4% 0.0% 0.0% 0.0% 27.12sec 34683809 300.00sec
Sentinel + Terror Sentinel + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror lava_burst 51505 86936991 289789 19.02 0 914266 95.3 95.1 100.0% 0.0% 0.0% 0.0% 3.10sec 86936991 300.00sec
Sentinel + Terror Sentinel + Terror lava_burst_overload 77451 41472967 138243 11.38 0 728794 57.1 56.9 100.0% 0.0% 0.0% 0.0% 5.10sec 41472967 300.00sec
Sentinel + Terror Sentinel + Terror volcanic_inferno 205533 3890812 12969 14.16 44201 90175 70.8 70.8 23.4% 0.0% 0.0% 0.0% 3.90sec 3890812 300.00sec
Sentinel + Terror Sentinel + Terror lightning_bolt 188196 24700001 82333 14.38 238654 688170 71.9 71.9 23.4% 0.0% 0.0% 0.0% 4.12sec 24700001 300.00sec
Sentinel + Terror Sentinel + Terror lightning_bolt_overload 45284 22120486 73735 14.90 206235 593994 74.5 74.5 23.4% 0.0% 0.0% 0.0% 5.15sec 22120486 300.00sec
Sentinel + Terror Sentinel + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Terror Sentinel + Terror spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.00sec
Sentinel + Terror Sentinel + Terror spectral_blast 246442 5496622 18322 7.26 121869 248614 36.3 36.3 23.4% 0.0% 0.0% 0.0% 7.33sec 5496622 300.00sec
Sentinel + Terror Sentinel + Terror spectral_bolt 242571 11282979 37610 18.40 98655 201256 92.0 92.0 23.4% 0.0% 0.0% 0.0% 2.86sec 11282979 300.00sec
Sentinel + Terror Sentinel + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.67sec 0 300.00sec
Sentinel + Terror Sentinel + Terror terror_from_below 242524 14812813 49376 1.93 1233906 2517168 9.7 9.7 23.3% 0.0% 0.0% 0.0% 29.54sec 14812813 300.00sec
Sentinel + Terror Sentinel + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.74sec 0 300.00sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental fire_blast 57984 39561828 201326 26.35 371722 743389 86.3 86.3 23.3% 0.0% 0.0% 0.0% 3.40sec 39561828 196.51sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental immolate 118297 1373264 6988 3.09 109944 219916 10.1 10.1 23.4% 0.0% 0.0% 0.0% 31.03sec 6311666 196.51sec
Sentinel + Terror Sentinel + Terror_primal_fire_elemental immolate ticks -118297 4938402 16461 20.27 39491 79039 10.1 101.3 23.4% 0.0% 0.0% 0.0% 31.03sec 6311666 196.51sec
Sentinel + Terror Sentinel + Terror_greater_lightning_elemental lightning_blast 191726 6932049 173301 55.50 151829 303722 37.0 37.0 23.4% 0.0% 0.0% 0.0% 7.04sec 6932049 40.00sec
Sentinel + Tome Sentinel + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.17sec 0 300.00sec
Sentinel + Tome Sentinel + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome earth_shock 8042 85216730 284055 10.07 1206262 3455315 50.4 50.4 21.6% 0.0% 0.0% 0.0% 5.78sec 85216730 300.00sec
Sentinel + Tome Sentinel + Tome fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 101.23sec 0 300.00sec
Sentinel + Tome Sentinel + Tome flame_shock 188389 2453533 8178 2.26 90324 264042 11.3 11.3 72.8% 0.0% 0.0% 0.0% 27.13sec 36180538 300.00sec
Sentinel + Tome Sentinel + Tome flame_shock ticks -188389 33727004 112423 42.37 49799 198898 11.3 211.8 73.4% 0.0% 0.0% 0.0% 27.13sec 36180538 300.00sec
Sentinel + Tome Sentinel + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome insidious_corruption ticks -243941 4410058 14700 9.40 77640 158477 5.0 47.0 20.0% 0.0% 0.0% 0.0% 60.53sec 4410058 300.00sec
Sentinel + Tome Sentinel + Tome lava_burst 51505 90510456 301701 19.01 0 952123 95.3 95.1 100.0% 0.0% 0.0% 0.0% 3.14sec 90510456 300.00sec
Sentinel + Tome Sentinel + Tome lava_burst_overload 77451 43150783 143836 11.37 0 758828 57.0 56.9 100.0% 0.0% 0.0% 0.0% 5.20sec 43150783 300.00sec
Sentinel + Tome Sentinel + Tome volcanic_inferno 205533 4038501 13462 14.18 46501 94857 70.9 70.9 21.6% 0.0% 0.0% 0.0% 3.99sec 4038501 300.00sec
Sentinel + Tome Sentinel + Tome lightning_bolt 188196 25272124 84240 14.40 252244 706323 72.0 72.0 21.8% 0.0% 0.0% 0.0% 4.05sec 25272124 300.00sec
Sentinel + Tome Sentinel + Tome lightning_bolt_overload 45284 22621362 75404 14.93 218003 609346 74.7 74.7 21.7% 0.0% 0.0% 0.0% 5.02sec 22621362 300.00sec
Sentinel + Tome Sentinel + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Sentinel + Tome Sentinel + Tome spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.44sec 0 300.00sec
Sentinel + Tome Sentinel + Tome spectral_blast 246442 5354170 17847 7.26 121869 248614 36.3 36.3 20.2% 0.0% 0.0% 0.0% 7.37sec 5354170 300.00sec
Sentinel + Tome Sentinel + Tome spectral_bolt 242571 10971704 36572 18.40 98655 201256 92.0 92.0 20.1% 0.0% 0.0% 0.0% 2.86sec 10971704 300.00sec
Sentinel + Tome Sentinel + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
Sentinel + Tome Sentinel + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.74sec 0 300.00sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental fire_blast 57984 40705323 209027 26.36 390969 781928 85.6 85.6 21.7% 0.0% 0.0% 0.0% 3.40sec 40705323 194.74sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental immolate 118297 1406833 7224 3.09 115658 231267 10.0 10.0 21.2% 0.0% 0.0% 0.0% 31.16sec 6485392 194.74sec
Sentinel + Tome Sentinel + Tome_primal_fire_elemental immolate ticks -118297 5078559 16929 20.12 41546 83119 10.0 100.6 21.5% 0.0% 0.0% 0.0% 31.16sec 6485392 194.74sec
Sentinel + Tome Sentinel + Tome_greater_lightning_elemental lightning_blast 191726 7102614 177565 55.50 159717 319531 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.03sec 7102614 40.00sec
Terror + Tome Terror + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.24sec 0 300.00sec
Terror + Tome Terror + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome earth_shock 8042 86865785 289552 9.83 1199797 3462745 49.2 49.2 25.1% 0.0% 0.0% 0.0% 5.89sec 86865785 300.00sec
Terror + Tome Terror + Tome fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 100.20sec 0 300.00sec
Terror + Tome Terror + Tome flame_shock 188389 2476599 8255 2.27 90415 263981 11.3 11.3 73.8% 0.0% 0.0% 0.0% 27.14sec 36756037 300.00sec
Terror + Tome Terror + Tome flame_shock ticks -188389 34279438 114265 42.37 49843 198257 11.3 211.8 75.5% 0.0% 0.0% 0.0% 27.14sec 36756037 300.00sec
Terror + Tome Terror + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome insidious_corruption ticks -243941 4543845 15146 9.40 77677 158588 5.1 47.0 23.4% 0.0% 0.0% 0.0% 60.41sec 4543845 300.00sec
Terror + Tome Terror + Tome lava_burst 51505 92571136 308570 19.01 0 973948 95.2 95.0 100.0% 0.0% 0.0% 0.0% 3.11sec 92571136 300.00sec
Terror + Tome Terror + Tome lava_burst_overload 77451 38671604 128905 9.96 0 776196 50.0 49.8 100.0% 0.0% 0.0% 0.0% 5.87sec 38671604 300.00sec
Terror + Tome Terror + Tome volcanic_inferno 205533 4164745 13882 14.17 46497 94858 70.9 70.9 25.4% 0.0% 0.0% 0.0% 3.92sec 4164745 300.00sec
Terror + Tome Terror + Tome lightning_bolt 188196 26524354 88414 14.57 251136 713517 72.9 72.9 24.4% 0.0% 0.0% 0.0% 4.06sec 26524354 300.00sec
Terror + Tome Terror + Tome lightning_bolt_overload 45284 22056191 73520 13.99 217390 618000 70.0 70.0 24.4% 0.0% 0.0% 0.0% 5.39sec 22056191 300.00sec
Terror + Tome Terror + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Terror + Tome Terror + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.68sec 0 300.00sec
Terror + Tome Terror + Tome terror_from_below 242524 15022013 50073 1.93 1233906 2517168 9.7 9.7 25.0% 0.0% 0.0% 0.0% 29.85sec 15022013 300.00sec
Terror + Tome Terror + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.70sec 0 300.00sec
Terror + Tome Terror + Tome_primal_fire_elemental fire_blast 57984 42444803 214125 26.34 390778 781753 87.0 87.0 24.8% 0.0% 0.0% 0.0% 3.39sec 42444803 198.22sec
Terror + Tome Terror + Tome_primal_fire_elemental immolate 118297 1476664 7449 3.09 115592 231361 10.2 10.2 25.2% 0.0% 0.0% 0.0% 30.88sec 6769769 198.22sec
Terror + Tome Terror + Tome_primal_fire_elemental immolate ticks -118297 5293105 17644 20.41 41547 83008 10.2 102.1 24.9% 0.0% 0.0% 0.0% 30.88sec 6769769 198.22sec
Terror + Tome Terror + Tome_greater_lightning_elemental lightning_blast 191726 7303864 182597 55.50 159744 319510 37.0 37.0 23.6% 0.0% 0.0% 0.0% 7.04sec 7303864 40.00sec
Thurible + Sentinel Thurible + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.16sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel earth_shock 8042 81534688 271782 10.08 1175710 3375573 50.4 50.4 20.1% 0.0% 0.0% 0.0% 5.78sec 81534688 300.00sec
Thurible + Sentinel Thurible + Sentinel fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 102.31sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel flame_shock 188389 2376925 7923 2.26 88046 257698 11.3 11.3 71.8% 0.0% 0.0% 0.0% 27.11sec 35072158 300.00sec
Thurible + Sentinel Thurible + Sentinel flame_shock ticks -188389 32695233 108984 42.37 48539 194416 11.3 211.8 72.5% 0.0% 0.0% 0.0% 27.11sec 35072158 300.00sec
Thurible + Sentinel Thurible + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel lava_burst 51505 87852332 292840 19.02 0 923605 95.3 95.1 100.0% 0.0% 0.0% 0.0% 3.12sec 87852332 300.00sec
Thurible + Sentinel Thurible + Sentinel lava_burst_overload 77451 41925817 139752 11.39 0 736096 57.1 57.0 100.0% 0.0% 0.0% 0.0% 5.15sec 41925817 300.00sec
Thurible + Sentinel Thurible + Sentinel volcanic_inferno 205533 3892037 12973 14.20 45368 92547 71.0 71.0 20.1% 0.0% 0.0% 0.0% 3.95sec 3892037 300.00sec
Thurible + Sentinel Thurible + Sentinel lightning_bolt 188196 24205634 80685 14.39 244489 704319 71.9 71.9 20.0% 0.0% 0.0% 0.0% 4.07sec 24205634 300.00sec
Thurible + Sentinel Thurible + Sentinel lightning_bolt_overload 45284 21665112 72217 14.91 211225 606880 74.6 74.6 20.1% 0.0% 0.0% 0.0% 5.09sec 21665112 300.00sec
Thurible + Sentinel Thurible + Sentinel piercing_anguish 246751 9437264 31457 3.20 487076 993635 16.2 16.0 20.1% 0.0% 0.0% 0.0% 18.30sec 9437264 300.00sec
Thurible + Sentinel Thurible + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.41sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_blast 246442 5496674 18322 7.26 125079 255161 36.3 36.3 20.2% 0.0% 0.0% 0.0% 7.36sec 5496674 300.00sec
Thurible + Sentinel Thurible + Sentinel spectral_bolt 242571 11263681 37546 18.40 101253 206556 92.0 92.0 20.1% 0.0% 0.0% 0.0% 2.86sec 11263681 300.00sec
Thurible + Sentinel Thurible + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.83sec 0 300.00sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental fire_blast 57984 38956919 201422 26.38 381656 763326 85.0 85.0 20.1% 0.0% 0.0% 0.0% 3.41sec 38956919 193.41sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental immolate 118297 1354261 7002 3.10 112886 225841 10.0 10.0 20.2% 0.0% 0.0% 0.0% 31.30sec 6224638 193.41sec
Thurible + Sentinel Thurible + Sentinel_primal_fire_elemental immolate ticks -118297 4870377 16235 20.01 40547 81094 10.0 100.0 20.1% 0.0% 0.0% 0.0% 31.30sec 6224638 193.41sec
Thurible + Sentinel Thurible + Sentinel_greater_lightning_elemental lightning_blast 191726 6927887 173197 55.50 155830 311717 37.0 37.0 20.1% 0.0% 0.0% 0.0% 7.03sec 6927887 40.00sec
Thurible + Terror Thurible + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.09sec 0 300.00sec
Thurible + Terror Thurible + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror earth_shock 8042 82813946 276046 9.84 1172013 3362396 49.2 49.2 23.3% 0.0% 0.0% 0.0% 5.89sec 82813946 300.00sec
Thurible + Terror Thurible + Terror fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 100.56sec 0 300.00sec
Thurible + Terror Thurible + Terror flame_shock 188389 2408841 8029 2.27 88106 257595 11.3 11.3 73.5% 0.0% 0.0% 0.0% 27.11sec 35590977 300.00sec
Thurible + Terror Thurible + Terror flame_shock ticks -188389 33182137 110607 42.36 48573 193784 11.3 211.8 74.4% 0.0% 0.0% 0.0% 27.11sec 35590977 300.00sec
Thurible + Terror Thurible + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror lava_burst 51505 89170270 297233 19.01 0 937901 95.3 95.1 100.0% 0.0% 0.0% 0.0% 3.11sec 89170270 300.00sec
Thurible + Terror Thurible + Terror lava_burst_overload 77451 37254767 124182 9.97 0 747634 50.0 49.8 100.0% 0.0% 0.0% 0.0% 5.83sec 37254767 300.00sec
Thurible + Terror Thurible + Terror volcanic_inferno 205533 3994934 13316 14.18 45368 92546 70.9 70.9 23.3% 0.0% 0.0% 0.0% 3.92sec 3994934 300.00sec
Thurible + Terror Thurible + Terror lightning_bolt 188196 25559490 85198 14.56 244154 702547 72.8 72.8 23.3% 0.0% 0.0% 0.0% 4.06sec 25559490 300.00sec
Thurible + Terror Thurible + Terror lightning_bolt_overload 45284 21272896 70909 13.98 211342 608710 69.9 69.9 23.4% 0.0% 0.0% 0.0% 5.39sec 21272896 300.00sec
Thurible + Terror Thurible + Terror piercing_anguish 246751 9696029 32320 3.20 487076 993635 16.2 16.0 23.5% 0.0% 0.0% 0.0% 18.23sec 9696029 300.00sec
Thurible + Terror Thurible + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Terror Thurible + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
Thurible + Terror Thurible + Terror terror_from_below 242524 15240053 50800 1.93 1266400 2583456 9.7 9.7 23.5% 0.0% 0.0% 0.0% 29.61sec 15240053 300.00sec
Thurible + Terror Thurible + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.82sec 0 300.00sec
Thurible + Terror Thurible + Terror_primal_fire_elemental fire_blast 57984 40603173 206625 26.35 381503 763016 86.3 86.3 23.3% 0.0% 0.0% 0.0% 3.39sec 40603173 196.51sec
Thurible + Terror Thurible + Terror_primal_fire_elemental immolate 118297 1408120 7166 3.09 112849 225655 10.1 10.1 23.3% 0.0% 0.0% 0.0% 31.01sec 6475547 196.51sec
Thurible + Terror Thurible + Terror_primal_fire_elemental immolate ticks -118297 5067427 16891 20.27 40538 81070 10.1 101.3 23.4% 0.0% 0.0% 0.0% 31.01sec 6475547 196.51sec
Thurible + Terror Thurible + Terror_greater_lightning_elemental lightning_blast 191726 7120267 178007 55.50 155828 311755 37.0 37.0 23.5% 0.0% 0.0% 0.0% 7.04sec 7120267 40.00sec
Thurible + Tome Thurible + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.31sec 0 300.00sec
Thurible + Tome Thurible + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome earth_shock 8042 85268251 284227 9.85 1229615 3550956 49.2 49.2 21.6% 0.0% 0.0% 0.0% 5.89sec 85268251 300.00sec
Thurible + Tome Thurible + Tome fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 101.90sec 0 300.00sec
Thurible + Tome Thurible + Tome flame_shock 188389 2506173 8354 2.26 92724 270992 11.3 11.3 72.1% 0.0% 0.0% 0.0% 27.12sec 37151913 300.00sec
Thurible + Tome Thurible + Tome flame_shock ticks -188389 34645740 115486 42.37 51117 204080 11.3 211.8 73.5% 0.0% 0.0% 0.0% 27.12sec 37151913 300.00sec
Thurible + Tome Thurible + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome insidious_corruption ticks -243941 4532831 15109 9.41 79716 162804 5.1 47.0 20.1% 0.0% 0.0% 0.0% 60.41sec 4532831 300.00sec
Thurible + Tome Thurible + Tome lava_burst 51505 93376838 311255 18.98 0 983852 95.1 94.9 100.0% 0.0% 0.0% 0.0% 3.14sec 93376838 300.00sec
Thurible + Tome Thurible + Tome lava_burst_overload 77451 39012948 130043 9.95 0 784172 49.9 49.8 100.0% 0.0% 0.0% 0.0% 5.91sec 39012948 300.00sec
Thurible + Tome Thurible + Tome volcanic_inferno 205533 4160161 13867 14.18 47725 97384 70.9 70.9 22.0% 0.0% 0.0% 0.0% 3.97sec 4160161 300.00sec
Thurible + Tome Thurible + Tome lightning_bolt 188196 26064815 86882 14.60 257074 730051 73.0 73.0 21.1% 0.0% 0.0% 0.0% 4.02sec 26064815 300.00sec
Thurible + Tome Thurible + Tome lightning_bolt_overload 45284 21647073 72157 14.02 222376 632543 70.1 70.1 21.1% 0.0% 0.0% 0.0% 5.33sec 21647073 300.00sec
Thurible + Tome Thurible + Tome piercing_anguish 246751 9575767 31919 3.21 487076 993635 16.2 16.0 21.7% 0.0% 0.0% 0.0% 18.09sec 9575767 300.00sec
Thurible + Tome Thurible + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Thurible + Tome Thurible + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.65sec 0 300.00sec
Thurible + Tome Thurible + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.82sec 0 300.00sec
Thurible + Tome Thurible + Tome_primal_fire_elemental fire_blast 57984 41781391 214391 26.37 401246 802577 85.6 85.6 21.6% 0.0% 0.0% 0.0% 3.41sec 41781391 194.88sec
Thurible + Tome Thurible + Tome_primal_fire_elemental immolate 118297 1455509 7469 3.09 118677 237505 10.0 10.0 22.1% 0.0% 0.0% 0.0% 31.21sec 6676148 194.88sec
Thurible + Tome Thurible + Tome_primal_fire_elemental immolate ticks -118297 5220639 17402 20.13 42650 85222 10.0 100.7 21.6% 0.0% 0.0% 0.0% 31.21sec 6676148 194.88sec
Thurible + Tome Thurible + Tome_greater_lightning_elemental lightning_blast 191726 7294171 182354 55.50 163944 327928 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.03sec 7294171 40.00sec
Whispers + Charm Whispers + Charm ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.78sec 0 300.00sec
Whispers + Charm Whispers + Charm augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm earth_shock 8042 89168611 297228 10.54 1231852 3534869 52.7 52.7 20.0% 0.0% 0.0% 0.0% 5.50sec 89168611 300.00sec
Whispers + Charm Whispers + Charm fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 97.37sec 0 300.00sec
Whispers + Charm Whispers + Charm flame_shock 188389 2563108 8544 2.26 93438 272112 11.3 11.3 74.4% 0.0% 0.0% 0.0% 27.10sec 40866199 300.00sec
Whispers + Charm Whispers + Charm flame_shock ticks -188389 38303091 127677 45.42 51522 206003 11.3 227.1 75.8% 0.0% 0.0% 0.0% 27.10sec 40866199 300.00sec
Whispers + Charm Whispers + Charm flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm lava_burst 51505 100337308 334457 20.41 0 983389 102.2 102.0 100.0% 0.0% 0.0% 0.0% 2.93sec 100337308 300.00sec
Whispers + Charm Whispers + Charm lava_burst_overload 77451 41939629 139798 10.70 0 783716 53.7 53.5 100.0% 0.0% 0.0% 0.0% 5.53sec 41939629 300.00sec
Whispers + Charm Whispers + Charm volcanic_inferno 205533 4415892 14720 15.22 48035 97991 76.1 76.1 20.0% 0.0% 0.0% 0.0% 3.72sec 4415892 300.00sec
Whispers + Charm Whispers + Charm lightning_bolt 188196 27244058 90813 15.63 253024 730411 78.1 78.1 20.0% 0.0% 0.0% 0.0% 3.72sec 27244058 300.00sec
Whispers + Charm Whispers + Charm lightning_bolt_overload 45284 22387898 74626 14.80 219784 632505 74.0 74.0 20.1% 0.0% 0.0% 0.0% 4.99sec 22387898 300.00sec
Whispers + Charm Whispers + Charm potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Charm Whispers + Charm stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.59sec 0 300.00sec
Whispers + Charm Whispers + Charm totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.61sec 0 300.00sec
Whispers + Charm Whispers + Charm_primal_fire_elemental fire_blast 57984 47183540 230994 28.61 403373 806780 97.4 97.4 20.1% 0.0% 0.0% 0.0% 3.04sec 47183540 204.26sec
Whispers + Charm Whispers + Charm_primal_fire_elemental immolate 118297 1499985 7343 3.07 119339 238673 10.5 10.5 20.1% 0.0% 0.0% 0.0% 30.20sec 7325931 204.26sec
Whispers + Charm Whispers + Charm_primal_fire_elemental immolate ticks -118297 5825946 19420 22.64 42861 85744 10.5 113.2 20.1% 0.0% 0.0% 0.0% 30.20sec 7325931 204.26sec
Whispers + Charm Whispers + Charm_greater_lightning_elemental lightning_blast 191726 7713916 192848 58.39 164962 330008 38.9 38.9 20.1% 0.0% 0.0% 0.0% 6.63sec 7713916 40.00sec
Whispers + Sentinel Whispers + Sentinel ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.11sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel earth_shock 8042 85721089 285736 10.53 1184256 3399990 52.6 52.6 20.1% 0.0% 0.0% 0.0% 5.52sec 85721089 300.00sec
Whispers + Sentinel Whispers + Sentinel fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 97.96sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel flame_shock 188389 2439021 8130 2.27 89264 260543 11.3 11.3 73.6% 0.0% 0.0% 0.0% 27.11sec 37643820 300.00sec
Whispers + Sentinel Whispers + Sentinel flame_shock ticks -188389 35204799 117349 44.20 49212 197034 11.3 221.0 74.5% 0.0% 0.0% 0.0% 27.11sec 37643820 300.00sec
Whispers + Sentinel Whispers + Sentinel flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel lava_burst 51505 92973234 309910 19.81 0 938529 99.3 99.1 100.0% 0.0% 0.0% 0.0% 2.98sec 92973234 300.00sec
Whispers + Sentinel Whispers + Sentinel lava_burst_overload 77451 44312986 147710 11.85 0 747980 59.4 59.2 100.0% 0.0% 0.0% 0.0% 4.93sec 44312986 300.00sec
Whispers + Sentinel Whispers + Sentinel volcanic_inferno 205533 4096415 13655 14.76 45941 93704 73.8 73.8 20.0% 0.0% 0.0% 0.0% 3.79sec 4096415 300.00sec
Whispers + Sentinel Whispers + Sentinel lightning_bolt 188196 25401925 84673 15.10 244337 703341 75.5 75.5 20.0% 0.0% 0.0% 0.0% 3.92sec 25401925 300.00sec
Whispers + Sentinel Whispers + Sentinel lightning_bolt_overload 45284 22633480 75445 15.54 211585 609400 77.7 77.7 20.0% 0.0% 0.0% 0.0% 4.90sec 22633480 300.00sec
Whispers + Sentinel Whispers + Sentinel potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel spectral_owl 242570 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 120.42sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel spectral_blast 246442 5372075 17907 7.29 121869 248614 36.4 36.4 20.2% 0.0% 0.0% 0.0% 7.35sec 5372075 300.00sec
Whispers + Sentinel Whispers + Sentinel spectral_bolt 242571 11472371 38241 19.24 98655 201256 96.2 96.2 20.1% 0.0% 0.0% 0.0% 2.73sec 11472371 300.00sec
Whispers + Sentinel Whispers + Sentinel stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.64sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.93sec 0 300.00sec
Whispers + Sentinel Whispers + Sentinel_primal_fire_elemental fire_blast 57984 42808813 212974 27.56 386026 772094 92.3 92.3 20.1% 0.0% 0.0% 0.0% 3.19sec 42808813 201.00sec
Whispers + Sentinel Whispers + Sentinel_primal_fire_elemental immolate 118297 1416619 7048 3.08 114198 228338 10.3 10.3 20.2% 0.0% 0.0% 0.0% 30.48sec 6739525 201.00sec
Whispers + Sentinel Whispers + Sentinel_primal_fire_elemental immolate ticks -118297 5322906 17743 21.64 40970 81979 10.3 108.2 20.1% 0.0% 0.0% 0.0% 30.48sec 6739525 201.00sec
Whispers + Sentinel Whispers + Sentinel_greater_lightning_elemental lightning_blast 191726 7314461 182862 57.88 157819 315651 38.6 38.6 20.1% 0.0% 0.0% 0.0% 6.75sec 7314461 40.00sec
Whispers + Terror Whispers + Terror ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.64sec 0 300.00sec
Whispers + Terror Whispers + Terror augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror earth_shock 8042 87271782 290905 10.29 1180031 3388876 51.4 51.4 23.4% 0.0% 0.0% 0.0% 5.67sec 87271782 300.00sec
Whispers + Terror Whispers + Terror fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 96.71sec 0 300.00sec
Whispers + Terror Whispers + Terror flame_shock 188389 2472317 8241 2.27 89325 260526 11.3 11.3 75.2% 0.0% 0.0% 0.0% 27.12sec 38185404 300.00sec
Whispers + Terror Whispers + Terror flame_shock ticks -188389 35713088 119044 44.19 49244 196523 11.3 221.0 76.3% 0.0% 0.0% 0.0% 27.12sec 38185404 300.00sec
Whispers + Terror Whispers + Terror flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror lava_burst 51505 94429437 314764 19.81 0 953342 99.3 99.1 100.0% 0.0% 0.0% 0.0% 3.00sec 94429437 300.00sec
Whispers + Terror Whispers + Terror lava_burst_overload 77451 39445736 131485 10.38 0 759760 52.1 51.9 100.0% 0.0% 0.0% 0.0% 5.66sec 39445736 300.00sec
Whispers + Terror Whispers + Terror volcanic_inferno 205533 4213922 14046 14.76 45936 93713 73.8 73.8 23.3% 0.0% 0.0% 0.0% 3.81sec 4213922 300.00sec
Whispers + Terror Whispers + Terror lightning_bolt 188196 26821682 89405 15.28 243993 702252 76.4 76.4 23.4% 0.0% 0.0% 0.0% 3.84sec 26821682 300.00sec
Whispers + Terror Whispers + Terror lightning_bolt_overload 45284 22179648 73932 14.55 211724 609085 72.8 72.8 23.4% 0.0% 0.0% 0.0% 5.12sec 22179648 300.00sec
Whispers + Terror Whispers + Terror potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Terror Whispers + Terror stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.61sec 0 300.00sec
Whispers + Terror Whispers + Terror terror_from_below 242524 14835210 49451 1.93 1233906 2517168 9.7 9.7 23.6% 0.0% 0.0% 0.0% 29.07sec 14835210 300.00sec
Whispers + Terror Whispers + Terror totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.71sec 0 300.00sec
Whispers + Terror Whispers + Terror_primal_fire_elemental fire_blast 57984 44602422 218498 27.55 385896 771825 93.7 93.7 23.3% 0.0% 0.0% 0.0% 3.16sec 44602422 204.13sec
Whispers + Terror Whispers + Terror_primal_fire_elemental immolate 118297 1474724 7224 3.08 114162 228343 10.5 10.5 23.4% 0.0% 0.0% 0.0% 30.15sec 7010568 204.13sec
Whispers + Terror Whispers + Terror_primal_fire_elemental immolate ticks -118297 5535844 18453 21.91 40962 81945 10.5 109.6 23.3% 0.0% 0.0% 0.0% 30.15sec 7010568 204.13sec
Whispers + Terror Whispers + Terror_greater_lightning_elemental lightning_blast 191726 7517409 187935 57.87 157823 315738 38.6 38.6 23.5% 0.0% 0.0% 0.0% 6.73sec 7517409 40.00sec
Whispers + Thurible Whispers + Thurible ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.15sec 0 300.00sec
Whispers + Thurible Whispers + Thurible augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible earth_shock 8042 85516072 285053 10.28 1209096 3471689 51.4 51.4 20.1% 0.0% 0.0% 0.0% 5.65sec 85516072 300.00sec
Whispers + Thurible Whispers + Thurible fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 98.17sec 0 300.00sec
Whispers + Thurible Whispers + Thurible flame_shock 188389 2503804 8346 2.27 91583 267444 11.3 11.3 73.6% 0.0% 0.0% 0.0% 27.10sec 38623623 300.00sec
Whispers + Thurible Whispers + Thurible flame_shock ticks -188389 36119819 120399 44.19 50507 202216 11.3 221.0 74.5% 0.0% 0.0% 0.0% 27.10sec 38623623 300.00sec
Whispers + Thurible Whispers + Thurible flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible lava_burst 51505 95230355 317434 19.79 0 962610 99.1 98.9 100.0% 0.0% 0.0% 0.0% 3.02sec 95230355 300.00sec
Whispers + Thurible Whispers + Thurible lava_burst_overload 77451 39800059 132667 10.38 0 767191 52.0 51.9 100.0% 0.0% 0.0% 0.0% 5.69sec 39800059 300.00sec
Whispers + Thurible Whispers + Thurible volcanic_inferno 205533 4201891 14006 14.75 47149 96176 73.7 73.7 20.0% 0.0% 0.0% 0.0% 3.78sec 4201891 300.00sec
Whispers + Thurible Whispers + Thurible lightning_bolt 188196 26341611 87805 15.32 249752 719911 76.6 76.6 20.0% 0.0% 0.0% 0.0% 3.82sec 26341611 300.00sec
Whispers + Thurible Whispers + Thurible lightning_bolt_overload 45284 21724919 72416 14.57 216708 623978 72.8 72.8 20.0% 0.0% 0.0% 0.0% 5.10sec 21724919 300.00sec
Whispers + Thurible Whispers + Thurible piercing_anguish 246751 9429503 31432 3.20 487076 993635 16.2 16.0 20.0% 0.0% 0.0% 0.0% 18.44sec 9429503 300.00sec
Whispers + Thurible Whispers + Thurible potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Thurible Whispers + Thurible stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.60sec 0 300.00sec
Whispers + Thurible Whispers + Thurible totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.52sec 0 300.00sec
Whispers + Thurible Whispers + Thurible_primal_fire_elemental fire_blast 57984 43906786 218567 27.56 396207 792405 92.3 92.3 20.1% 0.0% 0.0% 0.0% 3.21sec 43906786 200.88sec
Whispers + Thurible Whispers + Thurible_primal_fire_elemental immolate 118297 1451765 7227 3.08 117200 234455 10.3 10.3 20.0% 0.0% 0.0% 0.0% 30.60sec 6912279 200.88sec
Whispers + Thurible Whispers + Thurible_primal_fire_elemental immolate ticks -118297 5460514 18202 21.63 42051 84106 10.3 108.1 20.1% 0.0% 0.0% 0.0% 30.60sec 6912279 200.88sec
Whispers + Thurible Whispers + Thurible_greater_lightning_elemental lightning_blast 191726 7513302 187833 57.89 161971 324010 38.6 38.6 20.2% 0.0% 0.0% 0.0% 6.73sec 7513302 40.00sec
Whispers + Tome Whispers + Tome ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 185.93sec 0 300.00sec
Whispers + Tome Whispers + Tome augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome earth_shock 8042 89539759 298465 10.28 1236072 3571167 51.4 51.4 21.7% 0.0% 0.0% 0.0% 5.68sec 89539759 300.00sec
Whispers + Tome Whispers + Tome fire_elemental 198067 0 0 0.00 0 0 4.0 0.0 0.0% 0.0% 0.0% 0.0% 97.17sec 0 300.00sec
Whispers + Tome Whispers + Tome flame_shock 188389 2569674 8566 2.27 93796 273529 11.3 11.3 74.0% 0.0% 0.0% 0.0% 27.12sec 39823484 300.00sec
Whispers + Tome Whispers + Tome flame_shock ticks -188389 37253810 124179 44.19 51730 206483 11.3 221.0 75.5% 0.0% 0.0% 0.0% 27.12sec 39823484 300.00sec
Whispers + Tome Whispers + Tome flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome insidious_corruption ticks -243941 4643501 15478 9.76 78686 160633 5.1 48.8 20.1% 0.0% 0.0% 0.0% 60.37sec 4643501 300.00sec
Whispers + Tome Whispers + Tome lava_burst 51505 98713523 329044 19.78 0 998041 99.1 98.9 100.0% 0.0% 0.0% 0.0% 2.99sec 98713523 300.00sec
Whispers + Tome Whispers + Tome lava_burst_overload 77451 41240129 137467 10.37 0 795477 52.0 51.8 100.0% 0.0% 0.0% 0.0% 5.64sec 41240129 300.00sec
Whispers + Tome Whispers + Tome volcanic_inferno 205533 4370161 14567 14.74 48234 98421 73.7 73.7 22.0% 0.0% 0.0% 0.0% 3.78sec 4370161 300.00sec
Whispers + Tome Whispers + Tome lightning_bolt 188196 27287449 90958 15.32 256452 728455 76.6 76.6 21.1% 0.0% 0.0% 0.0% 3.85sec 27287449 300.00sec
Whispers + Tome Whispers + Tome lightning_bolt_overload 45284 22464467 74881 14.56 222499 632181 72.8 72.8 21.0% 0.0% 0.0% 0.0% 5.12sec 22464467 300.00sec
Whispers + Tome Whispers + Tome potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
Whispers + Tome Whispers + Tome stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.61sec 0 300.00sec
Whispers + Tome Whispers + Tome totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.72sec 0 300.00sec
Whispers + Tome Whispers + Tome_primal_fire_elemental fire_blast 57984 45825811 226033 27.55 405107 810368 93.1 93.1 21.5% 0.0% 0.0% 0.0% 3.18sec 45825811 202.74sec
Whispers + Tome Whispers + Tome_primal_fire_elemental immolate 118297 1520971 7502 3.08 119843 239836 10.4 10.4 22.0% 0.0% 0.0% 0.0% 30.27sec 7214899 202.74sec
Whispers + Tome Whispers + Tome_primal_fire_elemental immolate ticks -118297 5693928 18980 21.79 43018 85967 10.4 108.9 21.5% 0.0% 0.0% 0.0% 30.27sec 7214899 202.74sec
Whispers + Tome Whispers + Tome_greater_lightning_elemental lightning_blast 191726 7683814 192095 57.86 165697 331381 38.6 38.6 20.2% 0.0% 0.0% 0.0% 6.75sec 7683814 40.00sec
baseline baseline ascendance 114050 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 186.00sec 0 300.00sec
baseline baseline augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline earth_shock 8042 77216994 257389 9.85 1139724 3274682 49.2 49.2 20.1% 0.0% 0.0% 0.0% 5.90sec 77216994 300.00sec
baseline baseline fire_elemental 198067 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 102.89sec 0 300.00sec
baseline baseline flame_shock 188389 2317104 7724 2.26 85779 251081 11.3 11.3 71.9% 0.0% 0.0% 0.0% 27.13sec 34165891 300.00sec
baseline baseline flame_shock ticks -188389 31848787 106163 42.36 47287 189395 11.3 211.8 72.5% 0.0% 0.0% 0.0% 27.13sec 34165891 300.00sec
baseline baseline flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline lava_burst 51505 85384007 284613 18.99 0 899294 95.1 94.9 100.0% 0.0% 0.0% 0.0% 3.17sec 85384007 300.00sec
baseline baseline lava_burst_overload 77451 35660056 118867 9.95 0 716795 49.9 49.7 100.0% 0.0% 0.0% 0.0% 5.99sec 35660056 300.00sec
baseline baseline volcanic_inferno 205533 3781282 12604 14.16 44203 90181 70.8 70.8 20.0% 0.0% 0.0% 0.0% 4.05sec 3781282 300.00sec
baseline baseline lightning_bolt 188196 23833105 79443 14.59 237411 682975 73.0 73.0 20.0% 0.0% 0.0% 0.0% 3.96sec 23833105 300.00sec
baseline baseline lightning_bolt_overload 45284 19821990 66073 14.02 205370 591532 70.1 70.1 20.1% 0.0% 0.0% 0.0% 5.25sec 19821990 300.00sec
baseline baseline potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 300.00sec
baseline baseline stormkeeper 205495 0 0 0.00 0 0 5.0 0.0 0.0% 0.0% 0.0% 0.0% 61.66sec 0 300.00sec
baseline baseline totem_mastery 210643 0 0 0.00 0 0 3.0 0.0 0.0% 0.0% 0.0% 0.0% 113.53sec 0 300.00sec
baseline baseline_primal_fire_elemental fire_blast 57984 37938170 196266 26.38 371856 743813 85.0 85.0 20.1% 0.0% 0.0% 0.0% 3.42sec 37938170 193.30sec
baseline baseline_primal_fire_elemental immolate 118297 1318088 6819 3.10 109969 220033 10.0 10.0 20.2% 0.0% 0.0% 0.0% 31.47sec 6060807 193.30sec
baseline baseline_primal_fire_elemental immolate ticks -118297 4742719 15809 20.00 39505 79029 10.0 100.0 20.0% 0.0% 0.0% 0.0% 31.47sec 6060807 193.30sec
baseline baseline_greater_lightning_elemental lightning_blast 191726 6752889 168822 55.50 151827 303708 37.0 37.0 20.2% 0.0% 0.0% 0.0% 7.04sec 6752889 40.00sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
20082453.1 20082453.1 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 12.17% 12.17% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:12.17%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 11.14% 11.14% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:11.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.31% 9.31% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.31%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 10.34% 10.34% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:10.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 12.94% 12.94% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:12.94%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 9.46% 9.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:9.46%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 11.85% 11.85% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:11.85%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 10.03% 10.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:10.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 6.54% 6.54% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:6.54%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.22% 6.22% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.22%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 20082453.12
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 24999
Mean 300.00
Minimum 295.68
Maximum 304.32
Spread ( max - min ) 8.64
Range [ ( max - min ) / 2 * 100% ] 1.44%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 24999
Mean 20220753.16
Minimum 19176243.61
Maximum 21304833.06
Spread ( max - min ) 2128589.45
Range [ ( max - min ) / 2 * 100% ] 5.26%
Standard Deviation 285717.8981
5th Percentile 19758707.87
95th Percentile 20698014.66
( 95th Percentile - 5th Percentile ) 939306.78
Mean Distribution
Standard Deviation 1807.0748
95.00% Confidence Intervall ( 20217211.36 - 20224294.96 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 767
0.1 Scale Factor Error with Delta=300 696880901
0.05 Scale Factor Error with Delta=300 2787523601
0.01 Scale Factor Error with Delta=300 69688090008
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 24999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 6140813903 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 3474
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
spec=unknown
level=113
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.